Detailed information    

insolico Bioinformatically predicted

Overview

Name   spo0J   Type   Regulator
Locus tag   LBA42_RS07035 Genome accession   NZ_CP145437
Coordinates   1390344..1391102 (-) Length   252 a.a.
NCBI ID   WP_000410378.1    Uniprot ID   A0A064C0A8
Organism   Streptococcus pneumoniae strain HAC 39-1996     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1373590..1415904 1390344..1391102 within 0


Gene organization within MGE regions


Location: 1373590..1415904
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LBA42_RS06920 (LBA42_06920) - 1373590..1374756 (-) 1167 WP_000704684.1 site-specific integrase -
  LBA42_RS06925 (LBA42_06925) - 1374852..1375304 (-) 453 WP_000357940.1 type II toxin-antitoxin system death-on-curing family toxin -
  LBA42_RS06930 (LBA42_06930) - 1375304..1376308 (-) 1005 WP_000131181.1 hypothetical protein -
  LBA42_RS06935 (LBA42_06935) - 1376457..1377413 (-) 957 WP_001107586.1 helix-turn-helix transcriptional regulator -
  LBA42_RS06940 (LBA42_06940) - 1377570..1377803 (+) 234 WP_000438800.1 helix-turn-helix transcriptional regulator -
  LBA42_RS06945 (LBA42_06945) - 1377893..1378519 (+) 627 WP_000424667.1 Rha family transcriptional regulator -
  LBA42_RS06950 (LBA42_06950) - 1378971..1379423 (+) 453 WP_033606667.1 hypothetical protein -
  LBA42_RS06955 (LBA42_06955) - 1379420..1379620 (+) 201 WP_000171245.1 hypothetical protein -
  LBA42_RS06960 (LBA42_06960) - 1379622..1379837 (+) 216 WP_001003747.1 hypothetical protein -
  LBA42_RS06965 (LBA42_06965) - 1379834..1380127 (+) 294 WP_000122653.1 hypothetical protein -
  LBA42_RS06970 (LBA42_06970) - 1380108..1380449 (+) 342 WP_000058847.1 hypothetical protein -
  LBA42_RS06975 (LBA42_06975) - 1380442..1380717 (+) 276 WP_000492143.1 hypothetical protein -
  LBA42_RS06980 (LBA42_06980) - 1380857..1381717 (+) 861 WP_000158204.1 primase alpha helix C-terminal domain-containing protein -
  LBA42_RS06985 (LBA42_06985) - 1381761..1383239 (+) 1479 WP_000453487.1 DNA primase family protein -
  LBA42_RS06990 (LBA42_06990) - 1383580..1383747 (+) 168 WP_000865231.1 hypothetical protein -
  LBA42_RS06995 (LBA42_06995) - 1383830..1384360 (+) 531 Protein_1383 hypothetical protein -
  LBA42_RS07000 (LBA42_07000) - 1384431..1384688 (+) 258 WP_001810096.1 hypothetical protein -
  LBA42_RS07005 (LBA42_07005) - 1385617..1386027 (+) 411 WP_000187312.1 DUF1492 domain-containing protein -
  LBA42_RS07010 (LBA42_07010) - 1386183..1386575 (+) 393 WP_000417889.1 hypothetical protein -
  LBA42_RS07015 (LBA42_07015) - 1386629..1386787 (+) 159 WP_000568693.1 hypothetical protein -
  LBA42_RS07020 (LBA42_07020) - 1387216..1387410 (-) 195 WP_000285193.1 DUF951 family protein -
  LBA42_RS07025 (LBA42_07025) dnaN 1387475..1388611 (-) 1137 WP_000581157.1 DNA polymerase III subunit beta -
  LBA42_RS07030 (LBA42_07030) dnaA 1388770..1390131 (-) 1362 WP_000660618.1 chromosomal replication initiator protein DnaA -
  LBA42_RS07035 (LBA42_07035) spo0J 1390344..1391102 (-) 759 WP_000410378.1 ParB/RepB/Spo0J family partition protein Regulator
  LBA42_RS07040 (LBA42_07040) htrA 1391160..1392341 (-) 1182 WP_000681598.1 S1C family serine protease Regulator
  LBA42_RS07045 (LBA42_07045) rlmH 1392524..1393003 (+) 480 WP_000695929.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  LBA42_RS07055 (LBA42_07055) comC/comC1 1393285..1393410 (+) 126 WP_000799689.1 competence-stimulating peptide ComC Regulator
  LBA42_RS07060 (LBA42_07060) comD/comD1 1393431..1394756 (+) 1326 WP_000362880.1 competence system sensor histidine kinase ComD Regulator
  LBA42_RS07065 (LBA42_07065) comE 1394753..1395505 (+) 753 WP_000866065.1 competence system response regulator transcription factor ComE Regulator
  LBA42_RS07080 (LBA42_07080) - 1395748..1396290 (-) 543 WP_001158266.1 TetR/AcrR family transcriptional regulator -
  LBA42_RS07085 (LBA42_07085) - 1396469..1398072 (+) 1604 Protein_1398 YhgE/Pip domain-containing protein -
  LBA42_RS07090 (LBA42_07090) - 1398102..1400654 (-) 2553 WP_000834666.1 YfhO family protein -
  LBA42_RS07095 (LBA42_07095) - 1400716..1402338 (-) 1623 WP_000958769.1 ATP-binding cassette domain-containing protein -
  LBA42_RS07100 (LBA42_07100) trpS 1402544..1403569 (+) 1026 WP_000165446.1 tryptophan--tRNA ligase -
  LBA42_RS07105 (LBA42_07105) guaB 1403721..1405199 (+) 1479 WP_000073428.1 IMP dehydrogenase -
  LBA42_RS07110 (LBA42_07110) recF 1405250..1406347 (-) 1098 WP_000266661.1 DNA replication/repair protein RecF -
  LBA42_RS07115 (LBA42_07115) - 1406350..1406718 (-) 369 WP_000455898.1 RNA-binding S4 domain-containing protein -
  LBA42_RS07120 (LBA42_07120) - 1406877..1408127 (+) 1251 WP_000424269.1 pitrilysin family protein -
  LBA42_RS07125 (LBA42_07125) - 1408124..1409407 (+) 1284 WP_000170191.1 pitrilysin family protein -
  LBA42_RS07130 (LBA42_07130) rodZ 1409449..1410270 (+) 822 WP_001227958.1 cytoskeleton protein RodZ -
  LBA42_RS07135 (LBA42_07135) pgsA 1410281..1410826 (+) 546 WP_000712132.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  LBA42_RS07140 (LBA42_07140) - 1410823..1411650 (+) 828 WP_000835713.1 energy-coupling factor ABC transporter ATP-binding protein -
  LBA42_RS07145 (LBA42_07145) - 1411635..1412474 (+) 840 WP_000510412.1 energy-coupling factor transporter ATPase -
  LBA42_RS07150 (LBA42_07150) - 1412467..1413261 (+) 795 WP_000377893.1 energy-coupling factor transporter transmembrane protein EcfT -
  LBA42_RS07155 (LBA42_07155) mreC 1413320..1414138 (+) 819 WP_001078983.1 rod shape-determining protein MreC -
  LBA42_RS07160 (LBA42_07160) mreD 1414138..1414632 (+) 495 WP_001249454.1 rod shape-determining protein MreD -
  LBA42_RS07165 (LBA42_07165) - 1414726..1415904 (+) 1179 WP_000727012.1 CHAP domain-containing protein -

Sequence

Protein


Download         Length: 252 a.a.        Molecular weight: 29153.50 Da        Isoelectric Point: 9.0667

>NTDB_id=938703 LBA42_RS07035 WP_000410378.1 1390344..1391102(-) (spo0J) [Streptococcus pneumoniae strain HAC 39-1996]
MEKFEMISITDIQKNPYQPRKEFDREKLDELAQSIKENGVIQPIIVRQSPVIGYEILAGERRYRASLLAGLRSIPAVVKQ
ISDQEMMVQSIIENLQRENLNPIEEARAYESLVEKGFTHAEIADKMGKSRPYISNSIRLLSLPEQILSEVENGKLSQAHA
RSLVGLNKEQQDYFFQRIIEEDISVRKLEALLTEKKQKKQQKTNHFIQNEEKQLRKLLGLDVEIKLSKKDSGKIIISFSN
QEEYSRIINSLK

Nucleotide


Download         Length: 759 bp        

>NTDB_id=938703 LBA42_RS07035 WP_000410378.1 1390344..1391102(-) (spo0J) [Streptococcus pneumoniae strain HAC 39-1996]
ATGGAAAAATTTGAAATGATTTCTATCACAGATATACAAAAAAATCCCTATCAACCCCGAAAAGAATTTGATAGAGAAAA
ACTAGATGAACTAGCACAGTCTATCAAAGAAAATGGGGTCATTCAACCGATTATTGTTCGTCAATCTCCTGTTATTGGTT
ATGAAATCCTTGCAGGAGAGAGACGCTATCGGGCTTCACTTTTAGCTGGTCTACGGTCTATCCCAGCTGTTGTTAAACAG
ATTTCAGACCAAGAGATGATGGTCCAGTCCATTATTGAAAATTTACAGAGAGAAAATTTAAACCCAATAGAAGAAGCACG
CGCCTATGAATCTCTCGTAGAGAAAGGATTCACCCATGCTGAAATTGCAGATAAGATGGGCAAGTCTCGTCCATATATCA
GCAACTCCATTCGTTTACTTTCCTTGCCAGAACAGATTCTTTCAGAAGTAGAAAATGGCAAACTATCACAAGCCCATGCG
CGTTCCCTAGTTGGGTTAAATAAGGAACAACAAGACTATTTCTTTCAACGGATTATAGAAGAAGATATTTCTGTAAGGAA
ATTAGAAGCTCTTCTGACAGAGAAAAAACAAAAGAAACAGCAAAAAACTAATCATTTCATACAAAATGAAGAAAAACAGT
TAAGAAAACTACTCGGATTAGATGTAGAAATTAAACTATCTAAAAAAGACAGTGGAAAAATCATTATTTCTTTTTCAAAT
CAAGAAGAATATAGTAGAATTATCAACAGCCTGAAATAA

Domains

Predicted by InterproScan.

ParB/Sulfiredoxin domain (ParB_N)

(6-94)

HTH domain found in ParB protein (HTH_ParB)

(144-192)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A064C0A8

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  spo0J Streptococcus mutans UA159

50.593

100

0.508