Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   LBA42_RS04395 Genome accession   NZ_CP145437
Coordinates   878091..878240 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain HAC 39-1996     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 874007..879911 878091..878240 within 0


Gene organization within MGE regions


Location: 874007..879911
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LBA42_RS04370 (LBA42_04370) - 874007..875353 (-) 1347 WP_001837384.1 IS1380-like element ISSpn5 family transposase -
  LBA42_RS04375 (LBA42_04375) blpZ 875684..875917 (-) 234 WP_000276498.1 immunity protein BlpZ -
  LBA42_RS04380 (LBA42_04380) - 875959..876648 (-) 690 WP_000760521.1 CPBP family intramembrane glutamic endopeptidase -
  LBA42_RS04385 (LBA42_04385) - 876663..877082 (-) 420 WP_000877385.1 hypothetical protein -
  LBA42_RS04390 (LBA42_04390) - 877868..877987 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  LBA42_RS04395 (LBA42_04395) cipB 878091..878240 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  LBA42_RS04400 (LBA42_04400) blpN 878484..878687 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  LBA42_RS04405 (LBA42_04405) blpM 878703..878957 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  LBA42_RS04410 (LBA42_04410) - 879107..879911 (-) 805 Protein_874 IS5 family transposase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=938688 LBA42_RS04395 WP_001809846.1 878091..878240(-) (cipB) [Streptococcus pneumoniae strain HAC 39-1996]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=938688 LBA42_RS04395 WP_001809846.1 878091..878240(-) (cipB) [Streptococcus pneumoniae strain HAC 39-1996]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531