Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   V5F86_RS12560 Genome accession   NZ_CP145137
Coordinates   2481002..2481349 (-) Length   115 a.a.
NCBI ID   WP_268393877.1    Uniprot ID   -
Organism   Bacillus spizizenii strain kcgeb_sc     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2476002..2486349
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5F86_RS12515 (V5F86_12520) sinI 2476527..2476700 (+) 174 WP_338442836.1 anti-repressor SinI family protein Regulator
  V5F86_RS12520 (V5F86_12525) sinR 2476734..2477069 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  V5F86_RS12525 (V5F86_12530) tasA 2477163..2477948 (-) 786 WP_014114390.1 biofilm matrix protein TasA -
  V5F86_RS12530 (V5F86_12535) - 2478012..2478584 (-) 573 WP_338444517.1 signal peptidase I -
  V5F86_RS12535 (V5F86_12540) tapA 2478568..2479329 (-) 762 WP_338442837.1 amyloid fiber anchoring/assembly protein TapA -
  V5F86_RS12540 (V5F86_12545) - 2479599..2479925 (+) 327 WP_268393880.1 YqzG/YhdC family protein -
  V5F86_RS12545 (V5F86_12550) - 2479967..2480146 (-) 180 WP_003226330.1 YqzE family protein -
  V5F86_RS12550 (V5F86_12555) comGG 2480218..2480592 (-) 375 WP_268393879.1 competence type IV pilus minor pilin ComGG Machinery gene
  V5F86_RS12555 (V5F86_12560) comGF 2480593..2480976 (-) 384 WP_268393878.1 competence type IV pilus minor pilin ComGF Machinery gene
  V5F86_RS12560 (V5F86_12565) comGE 2481002..2481349 (-) 348 WP_268393877.1 competence type IV pilus minor pilin ComGE Machinery gene
  V5F86_RS12565 (V5F86_12570) comGD 2481333..2481764 (-) 432 Protein_2425 competence type IV pilus minor pilin ComGD -
  V5F86_RS12570 (V5F86_12575) comGC 2481754..2482050 (-) 297 WP_014114400.1 comG operon protein ComGC Machinery gene
  V5F86_RS12575 (V5F86_12580) comGB 2482064..2483101 (-) 1038 WP_338442838.1 competence type IV pilus assembly protein ComGB Machinery gene
  V5F86_RS12580 (V5F86_12585) comGA 2483088..2484158 (-) 1071 WP_268393875.1 competence protein ComGA Machinery gene
  V5F86_RS12585 (V5F86_12590) - 2484372..2484782 (-) 411 WP_338442839.1 CBS domain-containing protein -
  V5F86_RS12590 (V5F86_12595) - 2484845..2485798 (-) 954 WP_338442840.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13374.27 Da        Isoelectric Point: 4.1638

>NTDB_id=937421 V5F86_RS12560 WP_268393877.1 2481002..2481349(-) (comGE) [Bacillus spizizenii strain kcgeb_sc]
MWRENKGFSTIETMSALSLWLFLLLTVVPLWDKLIADENMAESREIGYQMMNESISKYMMTGEGTEMKTVANDDNNYTLK
WEEEGEYQNVCISAAAYKEKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=937421 V5F86_RS12560 WP_268393877.1 2481002..2481349(-) (comGE) [Bacillus spizizenii strain kcgeb_sc]
ATGTGGAGAGAAAATAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTGTGGCTGTTTCTGCTGCTGACAGT
CGTTCCTTTATGGGACAAGCTGATAGCTGATGAAAATATGGCGGAATCCCGAGAAATCGGCTATCAAATGATGAATGAAA
GCATTAGCAAATATATGATGACTGGTGAAGGAACTGAGATGAAAACGGTTGCAAATGACGATAATAACTATACGCTAAAG
TGGGAGGAGGAGGGGGAATATCAAAACGTATGCATCTCAGCAGCAGCTTATAAAGAAAAACCATTTTGCCTCAGCATTCT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

80.87

100

0.809