Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   V5G22_RS16160 Genome accession   NZ_CP144920
Coordinates   3164344..3164520 (-) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain CP26     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3159344..3169520
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5G22_RS16115 (V5G22_16115) comGE 3159679..3160026 (+) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  V5G22_RS16120 (V5G22_16120) comGF 3160052..3160423 (+) 372 WP_003183461.1 competence type IV pilus minor pilin ComGF -
  V5G22_RS16125 (V5G22_16125) comGG 3160436..3160801 (+) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  V5G22_RS16130 (V5G22_16130) - 3160890..3161072 (+) 183 WP_003183456.1 YqzE family protein -
  V5G22_RS16135 (V5G22_16135) - 3161096..3161383 (-) 288 WP_223307118.1 YqzG/YhdC family protein -
  V5G22_RS16140 (V5G22_16140) tapA 3161693..3162421 (+) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  V5G22_RS16145 (V5G22_16145) - 3162418..3163002 (+) 585 WP_003183449.1 signal peptidase I -
  V5G22_RS16150 (V5G22_16150) - 3163076..3163870 (+) 795 WP_003183447.1 TasA family protein -
  V5G22_RS16155 (V5G22_16155) sinR 3163975..3164310 (-) 336 WP_006637528.1 helix-turn-helix domain-containing protein Regulator
  V5G22_RS16160 (V5G22_16160) sinI 3164344..3164520 (-) 177 WP_003183444.1 anti-repressor SinI family protein Regulator
  V5G22_RS16165 (V5G22_16165) - 3164711..3165505 (-) 795 WP_003183441.1 YqhG family protein -
  V5G22_RS16170 (V5G22_16170) - 3165512..3167191 (-) 1680 WP_003183439.1 SNF2-related protein -
  V5G22_RS16175 (V5G22_16175) gcvT 3167784..3168878 (+) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=935222 V5G22_RS16160 WP_003183444.1 3164344..3164520(-) (sinI) [Bacillus licheniformis strain CP26]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=935222 V5G22_RS16160 WP_003183444.1 3164344..3164520(-) (sinI) [Bacillus licheniformis strain CP26]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517