Detailed information
Overview
| Name | abrB | Type | Regulator |
| Locus tag | V5G22_RS11120 | Genome accession | NZ_CP144920 |
| Coordinates | 2227630..2227914 (+) | Length | 94 a.a. |
| NCBI ID | WP_003185421.1 | Uniprot ID | A0A1Y0XQV9 |
| Organism | Bacillus licheniformis strain CP26 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2226814..2276259 | 2227630..2227914 | within | 0 |
Gene organization within MGE regions
Location: 2226814..2276259
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V5G22_RS11110 (V5G22_11110) | - | 2226814..2227215 (-) | 402 | WP_009329609.1 | transcriptional regulator | - |
| V5G22_RS11115 (V5G22_11115) | - | 2227368..2227601 (+) | 234 | WP_085959538.1 | helix-turn-helix transcriptional regulator | - |
| V5G22_RS11120 (V5G22_11120) | abrB | 2227630..2227914 (+) | 285 | WP_003185421.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| V5G22_RS11125 (V5G22_11125) | secG | 2228085..2228315 (+) | 231 | WP_003185418.1 | preprotein translocase subunit SecG | - |
| V5G22_RS11130 (V5G22_11130) | - | 2228456..2229202 (+) | 747 | WP_011198329.1 | carboxylesterase | - |
| V5G22_RS11135 (V5G22_11135) | rnr | 2229216..2231519 (+) | 2304 | WP_003185414.1 | ribonuclease R | - |
| V5G22_RS11140 (V5G22_11140) | smpB | 2231631..2232104 (+) | 474 | WP_009329604.1 | SsrA-binding protein SmpB | - |
| V5G22_RS11150 (V5G22_11150) | - | 2232656..2233750 (-) | 1095 | WP_003185410.1 | site-specific integrase | - |
| V5G22_RS11155 (V5G22_11155) | - | 2233821..2234471 (-) | 651 | WP_016886531.1 | LexA family transcriptional regulator | - |
| V5G22_RS11160 (V5G22_11160) | - | 2234628..2234867 (+) | 240 | WP_016886532.1 | helix-turn-helix transcriptional regulator | - |
| V5G22_RS11165 (V5G22_11165) | - | 2234882..2235151 (+) | 270 | WP_016886533.1 | hypothetical protein | - |
| V5G22_RS11170 (V5G22_11170) | - | 2235114..2235431 (-) | 318 | WP_016886534.1 | hypothetical protein | - |
| V5G22_RS11175 (V5G22_11175) | - | 2235493..2236287 (+) | 795 | WP_016886535.1 | ORF6N domain-containing protein | - |
| V5G22_RS11180 (V5G22_11180) | - | 2236284..2236472 (+) | 189 | WP_003185403.1 | helix-turn-helix domain-containing protein | - |
| V5G22_RS11185 (V5G22_11185) | - | 2236604..2236792 (+) | 189 | WP_016886536.1 | hypothetical protein | - |
| V5G22_RS11190 (V5G22_11190) | - | 2236850..2237404 (+) | 555 | WP_003185401.1 | hypothetical protein | - |
| V5G22_RS11195 (V5G22_11195) | - | 2237530..2237685 (+) | 156 | WP_155266364.1 | hypothetical protein | - |
| V5G22_RS11200 (V5G22_11200) | - | 2237657..2238208 (-) | 552 | WP_016886538.1 | hypothetical protein | - |
| V5G22_RS11205 (V5G22_11205) | - | 2238271..2238537 (+) | 267 | WP_009330095.1 | YqaH family protein | - |
| V5G22_RS11210 (V5G22_11210) | - | 2238625..2238867 (+) | 243 | WP_011198322.1 | hypothetical protein | - |
| V5G22_RS11215 (V5G22_11215) | - | 2238959..2239519 (+) | 561 | WP_016886540.1 | host-nuclease inhibitor Gam family protein | - |
| V5G22_RS11220 (V5G22_11220) | - | 2239523..2240455 (+) | 933 | WP_011198320.1 | AAA family ATPase | - |
| V5G22_RS11225 (V5G22_11225) | - | 2240455..2240892 (+) | 438 | WP_003185383.1 | DUF669 domain-containing protein | - |
| V5G22_RS11230 (V5G22_11230) | - | 2240953..2243385 (+) | 2433 | WP_016886541.1 | phage/plasmid primase, P4 family | - |
| V5G22_RS11235 (V5G22_11235) | - | 2243661..2243924 (+) | 264 | WP_016886542.1 | hypothetical protein | - |
| V5G22_RS11240 (V5G22_11240) | - | 2243902..2244339 (+) | 438 | WP_011198317.1 | hypothetical protein | - |
| V5G22_RS11245 (V5G22_11245) | - | 2244336..2244875 (+) | 540 | WP_009329253.1 | ERCC4 domain-containing protein | - |
| V5G22_RS11250 (V5G22_11250) | - | 2244872..2245042 (+) | 171 | WP_009329251.1 | Fur-regulated basic protein FbpA | - |
| V5G22_RS11255 (V5G22_11255) | - | 2245045..2245167 (+) | 123 | WP_257227968.1 | hypothetical protein | - |
| V5G22_RS11260 (V5G22_11260) | - | 2245130..2245558 (+) | 429 | WP_011201737.1 | putative metallopeptidase | - |
| V5G22_RS11265 (V5G22_11265) | - | 2245628..2245900 (+) | 273 | WP_011198316.1 | DUF5052 family protein | - |
| V5G22_RS11270 (V5G22_11270) | - | 2246027..2246407 (+) | 381 | WP_009329244.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| V5G22_RS11275 (V5G22_11275) | cotD | 2247146..2247370 (+) | 225 | WP_006637235.1 | spore coat protein CotD | - |
| V5G22_RS11280 (V5G22_11280) | - | 2247587..2247895 (+) | 309 | WP_016886543.1 | hypothetical protein | - |
| V5G22_RS11285 (V5G22_11285) | - | 2247922..2248296 (+) | 375 | WP_011198314.1 | HNH endonuclease | - |
| V5G22_RS11290 (V5G22_11290) | - | 2248527..2249042 (+) | 516 | WP_011198313.1 | phage terminase small subunit P27 family | - |
| V5G22_RS11295 (V5G22_11295) | - | 2249039..2250748 (+) | 1710 | WP_017474887.1 | terminase TerL endonuclease subunit | - |
| V5G22_RS11300 (V5G22_11300) | - | 2250760..2250951 (+) | 192 | WP_006637242.1 | DUF1056 family protein | - |
| V5G22_RS11305 (V5G22_11305) | - | 2250952..2252262 (+) | 1311 | WP_016886546.1 | phage portal protein | - |
| V5G22_RS11310 (V5G22_11310) | - | 2252207..2252938 (+) | 732 | WP_016886547.1 | head maturation protease, ClpP-related | - |
| V5G22_RS11315 (V5G22_11315) | - | 2253008..2254291 (+) | 1284 | WP_025805204.1 | phage major capsid protein | - |
| V5G22_RS11320 (V5G22_11320) | - | 2254316..2254753 (+) | 438 | WP_029326520.1 | collagen-like protein | - |
| V5G22_RS11325 (V5G22_11325) | - | 2254764..2255066 (+) | 303 | WP_016886549.1 | head-tail connector protein | - |
| V5G22_RS11330 (V5G22_11330) | - | 2255056..2255364 (+) | 309 | WP_016886550.1 | phage head closure protein | - |
| V5G22_RS11335 (V5G22_11335) | - | 2255364..2255762 (+) | 399 | WP_016886551.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| V5G22_RS11340 (V5G22_11340) | - | 2255759..2256142 (+) | 384 | WP_003185344.1 | hypothetical protein | - |
| V5G22_RS11345 (V5G22_11345) | - | 2256157..2256774 (+) | 618 | WP_016886552.1 | major tail protein | - |
| V5G22_RS11350 (V5G22_11350) | - | 2256827..2257189 (+) | 363 | WP_003185339.1 | hypothetical protein | - |
| V5G22_RS11355 (V5G22_11355) | - | 2257398..2261867 (+) | 4470 | WP_016886553.1 | phage tail tape measure protein | - |
| V5G22_RS11360 (V5G22_11360) | - | 2261867..2262703 (+) | 837 | WP_044789353.1 | phage tail family protein | - |
| V5G22_RS11365 (V5G22_11365) | - | 2262716..2264428 (+) | 1713 | WP_044789351.1 | phage tail protein | - |
| V5G22_RS11370 (V5G22_11370) | - | 2264465..2267110 (+) | 2646 | WP_144619827.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| V5G22_RS11375 (V5G22_11375) | - | 2267124..2268500 (+) | 1377 | WP_044789346.1 | phage baseplate upper protein | - |
| V5G22_RS11380 (V5G22_11380) | - | 2268513..2268836 (+) | 324 | WP_044789345.1 | hypothetical protein | - |
| V5G22_RS11385 (V5G22_11385) | - | 2268833..2269018 (+) | 186 | WP_003185324.1 | XkdX family protein | - |
| V5G22_RS11390 (V5G22_11390) | - | 2269081..2269350 (+) | 270 | WP_009329192.1 | hemolysin XhlA family protein | - |
| V5G22_RS11395 (V5G22_11395) | - | 2269366..2269629 (+) | 264 | WP_011198302.1 | phage holin | - |
| V5G22_RS11400 (V5G22_11400) | - | 2269681..2270760 (+) | 1080 | WP_011198301.1 | N-acetylmuramoyl-L-alanine amidase | - |
| V5G22_RS11405 (V5G22_11405) | - | 2270817..2271155 (-) | 339 | WP_011198300.1 | hypothetical protein | - |
| V5G22_RS11410 (V5G22_11410) | - | 2271171..2272700 (-) | 1530 | WP_011198299.1 | T7SS effector LXG polymorphic toxin | - |
| V5G22_RS11415 (V5G22_11415) | - | 2272971..2273993 (+) | 1023 | WP_011198298.1 | hypothetical protein | - |
| V5G22_RS11420 (V5G22_11420) | - | 2274100..2274243 (+) | 144 | WP_021837703.1 | hypothetical protein | - |
| V5G22_RS11425 (V5G22_11425) | - | 2274498..2274728 (+) | 231 | WP_011198296.1 | helix-turn-helix domain-containing protein | - |
| V5G22_RS11430 (V5G22_11430) | - | 2274908..2275000 (+) | 93 | Protein_2205 | peptidoglycan-binding domain-containing protein | - |
| V5G22_RS11435 (V5G22_11435) | - | 2275245..2275814 (-) | 570 | WP_011198295.1 | hypothetical protein | - |
| V5G22_RS11440 (V5G22_11440) | - | 2276041..2276259 (+) | 219 | WP_011198294.1 | transcriptional regulator | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10486.36 Da Isoelectric Point: 7.9620
>NTDB_id=935202 V5G22_RS11120 WP_003185421.1 2227630..2227914(+) (abrB) [Bacillus licheniformis strain CP26]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK
Nucleotide
Download Length: 285 bp
>NTDB_id=935202 V5G22_RS11120 WP_003185421.1 2227630..2227914(+) (abrB) [Bacillus licheniformis strain CP26]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
56.044 |
96.809 |
0.543 |