Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   V5G22_RS11120 Genome accession   NZ_CP144920
Coordinates   2227630..2227914 (+) Length   94 a.a.
NCBI ID   WP_003185421.1    Uniprot ID   A0A1Y0XQV9
Organism   Bacillus licheniformis strain CP26     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2226814..2276259 2227630..2227914 within 0


Gene organization within MGE regions


Location: 2226814..2276259
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5G22_RS11110 (V5G22_11110) - 2226814..2227215 (-) 402 WP_009329609.1 transcriptional regulator -
  V5G22_RS11115 (V5G22_11115) - 2227368..2227601 (+) 234 WP_085959538.1 helix-turn-helix transcriptional regulator -
  V5G22_RS11120 (V5G22_11120) abrB 2227630..2227914 (+) 285 WP_003185421.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  V5G22_RS11125 (V5G22_11125) secG 2228085..2228315 (+) 231 WP_003185418.1 preprotein translocase subunit SecG -
  V5G22_RS11130 (V5G22_11130) - 2228456..2229202 (+) 747 WP_011198329.1 carboxylesterase -
  V5G22_RS11135 (V5G22_11135) rnr 2229216..2231519 (+) 2304 WP_003185414.1 ribonuclease R -
  V5G22_RS11140 (V5G22_11140) smpB 2231631..2232104 (+) 474 WP_009329604.1 SsrA-binding protein SmpB -
  V5G22_RS11150 (V5G22_11150) - 2232656..2233750 (-) 1095 WP_003185410.1 site-specific integrase -
  V5G22_RS11155 (V5G22_11155) - 2233821..2234471 (-) 651 WP_016886531.1 LexA family transcriptional regulator -
  V5G22_RS11160 (V5G22_11160) - 2234628..2234867 (+) 240 WP_016886532.1 helix-turn-helix transcriptional regulator -
  V5G22_RS11165 (V5G22_11165) - 2234882..2235151 (+) 270 WP_016886533.1 hypothetical protein -
  V5G22_RS11170 (V5G22_11170) - 2235114..2235431 (-) 318 WP_016886534.1 hypothetical protein -
  V5G22_RS11175 (V5G22_11175) - 2235493..2236287 (+) 795 WP_016886535.1 ORF6N domain-containing protein -
  V5G22_RS11180 (V5G22_11180) - 2236284..2236472 (+) 189 WP_003185403.1 helix-turn-helix domain-containing protein -
  V5G22_RS11185 (V5G22_11185) - 2236604..2236792 (+) 189 WP_016886536.1 hypothetical protein -
  V5G22_RS11190 (V5G22_11190) - 2236850..2237404 (+) 555 WP_003185401.1 hypothetical protein -
  V5G22_RS11195 (V5G22_11195) - 2237530..2237685 (+) 156 WP_155266364.1 hypothetical protein -
  V5G22_RS11200 (V5G22_11200) - 2237657..2238208 (-) 552 WP_016886538.1 hypothetical protein -
  V5G22_RS11205 (V5G22_11205) - 2238271..2238537 (+) 267 WP_009330095.1 YqaH family protein -
  V5G22_RS11210 (V5G22_11210) - 2238625..2238867 (+) 243 WP_011198322.1 hypothetical protein -
  V5G22_RS11215 (V5G22_11215) - 2238959..2239519 (+) 561 WP_016886540.1 host-nuclease inhibitor Gam family protein -
  V5G22_RS11220 (V5G22_11220) - 2239523..2240455 (+) 933 WP_011198320.1 AAA family ATPase -
  V5G22_RS11225 (V5G22_11225) - 2240455..2240892 (+) 438 WP_003185383.1 DUF669 domain-containing protein -
  V5G22_RS11230 (V5G22_11230) - 2240953..2243385 (+) 2433 WP_016886541.1 phage/plasmid primase, P4 family -
  V5G22_RS11235 (V5G22_11235) - 2243661..2243924 (+) 264 WP_016886542.1 hypothetical protein -
  V5G22_RS11240 (V5G22_11240) - 2243902..2244339 (+) 438 WP_011198317.1 hypothetical protein -
  V5G22_RS11245 (V5G22_11245) - 2244336..2244875 (+) 540 WP_009329253.1 ERCC4 domain-containing protein -
  V5G22_RS11250 (V5G22_11250) - 2244872..2245042 (+) 171 WP_009329251.1 Fur-regulated basic protein FbpA -
  V5G22_RS11255 (V5G22_11255) - 2245045..2245167 (+) 123 WP_257227968.1 hypothetical protein -
  V5G22_RS11260 (V5G22_11260) - 2245130..2245558 (+) 429 WP_011201737.1 putative metallopeptidase -
  V5G22_RS11265 (V5G22_11265) - 2245628..2245900 (+) 273 WP_011198316.1 DUF5052 family protein -
  V5G22_RS11270 (V5G22_11270) - 2246027..2246407 (+) 381 WP_009329244.1 ArpU family phage packaging/lysis transcriptional regulator -
  V5G22_RS11275 (V5G22_11275) cotD 2247146..2247370 (+) 225 WP_006637235.1 spore coat protein CotD -
  V5G22_RS11280 (V5G22_11280) - 2247587..2247895 (+) 309 WP_016886543.1 hypothetical protein -
  V5G22_RS11285 (V5G22_11285) - 2247922..2248296 (+) 375 WP_011198314.1 HNH endonuclease -
  V5G22_RS11290 (V5G22_11290) - 2248527..2249042 (+) 516 WP_011198313.1 phage terminase small subunit P27 family -
  V5G22_RS11295 (V5G22_11295) - 2249039..2250748 (+) 1710 WP_017474887.1 terminase TerL endonuclease subunit -
  V5G22_RS11300 (V5G22_11300) - 2250760..2250951 (+) 192 WP_006637242.1 DUF1056 family protein -
  V5G22_RS11305 (V5G22_11305) - 2250952..2252262 (+) 1311 WP_016886546.1 phage portal protein -
  V5G22_RS11310 (V5G22_11310) - 2252207..2252938 (+) 732 WP_016886547.1 head maturation protease, ClpP-related -
  V5G22_RS11315 (V5G22_11315) - 2253008..2254291 (+) 1284 WP_025805204.1 phage major capsid protein -
  V5G22_RS11320 (V5G22_11320) - 2254316..2254753 (+) 438 WP_029326520.1 collagen-like protein -
  V5G22_RS11325 (V5G22_11325) - 2254764..2255066 (+) 303 WP_016886549.1 head-tail connector protein -
  V5G22_RS11330 (V5G22_11330) - 2255056..2255364 (+) 309 WP_016886550.1 phage head closure protein -
  V5G22_RS11335 (V5G22_11335) - 2255364..2255762 (+) 399 WP_016886551.1 HK97-gp10 family putative phage morphogenesis protein -
  V5G22_RS11340 (V5G22_11340) - 2255759..2256142 (+) 384 WP_003185344.1 hypothetical protein -
  V5G22_RS11345 (V5G22_11345) - 2256157..2256774 (+) 618 WP_016886552.1 major tail protein -
  V5G22_RS11350 (V5G22_11350) - 2256827..2257189 (+) 363 WP_003185339.1 hypothetical protein -
  V5G22_RS11355 (V5G22_11355) - 2257398..2261867 (+) 4470 WP_016886553.1 phage tail tape measure protein -
  V5G22_RS11360 (V5G22_11360) - 2261867..2262703 (+) 837 WP_044789353.1 phage tail family protein -
  V5G22_RS11365 (V5G22_11365) - 2262716..2264428 (+) 1713 WP_044789351.1 phage tail protein -
  V5G22_RS11370 (V5G22_11370) - 2264465..2267110 (+) 2646 WP_144619827.1 peptidase G2 autoproteolytic cleavage domain-containing protein -
  V5G22_RS11375 (V5G22_11375) - 2267124..2268500 (+) 1377 WP_044789346.1 phage baseplate upper protein -
  V5G22_RS11380 (V5G22_11380) - 2268513..2268836 (+) 324 WP_044789345.1 hypothetical protein -
  V5G22_RS11385 (V5G22_11385) - 2268833..2269018 (+) 186 WP_003185324.1 XkdX family protein -
  V5G22_RS11390 (V5G22_11390) - 2269081..2269350 (+) 270 WP_009329192.1 hemolysin XhlA family protein -
  V5G22_RS11395 (V5G22_11395) - 2269366..2269629 (+) 264 WP_011198302.1 phage holin -
  V5G22_RS11400 (V5G22_11400) - 2269681..2270760 (+) 1080 WP_011198301.1 N-acetylmuramoyl-L-alanine amidase -
  V5G22_RS11405 (V5G22_11405) - 2270817..2271155 (-) 339 WP_011198300.1 hypothetical protein -
  V5G22_RS11410 (V5G22_11410) - 2271171..2272700 (-) 1530 WP_011198299.1 T7SS effector LXG polymorphic toxin -
  V5G22_RS11415 (V5G22_11415) - 2272971..2273993 (+) 1023 WP_011198298.1 hypothetical protein -
  V5G22_RS11420 (V5G22_11420) - 2274100..2274243 (+) 144 WP_021837703.1 hypothetical protein -
  V5G22_RS11425 (V5G22_11425) - 2274498..2274728 (+) 231 WP_011198296.1 helix-turn-helix domain-containing protein -
  V5G22_RS11430 (V5G22_11430) - 2274908..2275000 (+) 93 Protein_2205 peptidoglycan-binding domain-containing protein -
  V5G22_RS11435 (V5G22_11435) - 2275245..2275814 (-) 570 WP_011198295.1 hypothetical protein -
  V5G22_RS11440 (V5G22_11440) - 2276041..2276259 (+) 219 WP_011198294.1 transcriptional regulator -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10486.36 Da        Isoelectric Point: 7.9620

>NTDB_id=935202 V5G22_RS11120 WP_003185421.1 2227630..2227914(+) (abrB) [Bacillus licheniformis strain CP26]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=935202 V5G22_RS11120 WP_003185421.1 2227630..2227914(+) (abrB) [Bacillus licheniformis strain CP26]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1Y0XQV9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

96.809

0.543