Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   V3829_RS18300 Genome accession   NZ_CP144358
Coordinates   3677934..3678053 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain DJ4     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3672934..3683053
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V3829_RS18275 - 3673172..3673930 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  V3829_RS18280 - 3673924..3674871 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  V3829_RS18285 ceuB 3674861..3675814 (-) 954 WP_046559346.1 ABC transporter permease Machinery gene
  V3829_RS18290 - 3676229..3677593 (+) 1365 WP_046559345.1 aspartate kinase -
  V3829_RS18295 - 3677673..3677783 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  V3829_RS18300 phrC 3677934..3678053 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  V3829_RS18305 - 3678037..3679187 (-) 1151 Protein_3551 tetratricopeptide repeat protein -
  V3829_RS18310 - 3679340..3680773 (-) 1434 WP_161625271.1 sensor histidine kinase -
  V3829_RS18315 - 3680760..3681443 (-) 684 WP_003156341.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=933757 V3829_RS18300 WP_003156334.1 3677934..3678053(-) (phrC) [Bacillus velezensis strain DJ4]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=933757 V3829_RS18300 WP_003156334.1 3677934..3678053(-) (phrC) [Bacillus velezensis strain DJ4]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718