Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   V2176_RS15295 Genome accession   NZ_CP143963
Coordinates   2901325..2901465 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain FUA2151     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2896325..2906465
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V2176_RS15270 (V2176_15270) - 2896596..2896985 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  V2176_RS15275 (V2176_15275) comA 2897002..2897640 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  V2176_RS15280 (V2176_15280) comP 2897727..2900048 (-) 2322 WP_330937911.1 ATP-binding protein Regulator
  V2176_RS15285 (V2176_15285) comX 2900088..2900252 (-) 165 WP_011198251.1 competence pheromone ComX -
  V2176_RS15290 (V2176_15290) - 2900267..2901136 (-) 870 WP_330937912.1 polyprenyl synthetase family protein -
  V2176_RS15295 (V2176_15295) degQ 2901325..2901465 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  V2176_RS15300 (V2176_15300) - 2901951..2902298 (+) 348 WP_009329512.1 hypothetical protein -
  V2176_RS15305 (V2176_15305) - 2902341..2903561 (-) 1221 WP_330937913.1 EAL and HDOD domain-containing protein -
  V2176_RS15310 (V2176_15310) - 2903740..2905149 (-) 1410 WP_228767691.1 nicotinate phosphoribosyltransferase -
  V2176_RS15315 (V2176_15315) - 2905227..2905778 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  V2176_RS15320 (V2176_15320) - 2905963..2906364 (-) 402 WP_330937914.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=932298 V2176_RS15295 WP_003184860.1 2901325..2901465(-) (degQ) [Bacillus licheniformis strain FUA2151]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=932298 V2176_RS15295 WP_003184860.1 2901325..2901465(-) (degQ) [Bacillus licheniformis strain FUA2151]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652