Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   VXF94_RS18980 Genome accession   NZ_CP143956
Coordinates   3664567..3664740 (-) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain Fad 108     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3659567..3669740
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VXF94_RS18930 (VXF94_18930) comGD 3659689..3660126 (+) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  VXF94_RS18935 (VXF94_18935) comGE 3660110..3660424 (+) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  VXF94_RS18940 (VXF94_18940) comGF 3660333..3660833 (+) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  VXF94_RS18945 (VXF94_18945) comGG 3660835..3661212 (+) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  VXF94_RS18950 (VXF94_18950) - 3661266..3661445 (+) 180 WP_013352866.1 YqzE family protein -
  VXF94_RS18955 (VXF94_18955) - 3661486..3661815 (-) 330 WP_013352865.1 DUF3889 domain-containing protein -
  VXF94_RS18960 (VXF94_18960) tapA 3662073..3662744 (+) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  VXF94_RS18965 (VXF94_18965) sipW 3662716..3663300 (+) 585 WP_013352863.1 signal peptidase I SipW -
  VXF94_RS18970 (VXF94_18970) tasA 3663365..3664150 (+) 786 WP_013352862.1 biofilm matrix protein TasA -
  VXF94_RS18975 (VXF94_18975) sinR 3664198..3664533 (-) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  VXF94_RS18980 (VXF94_18980) sinI 3664567..3664740 (-) 174 WP_013352860.1 anti-repressor SinI Regulator
  VXF94_RS18985 (VXF94_18985) - 3664920..3665714 (-) 795 WP_014472099.1 YqhG family protein -
  VXF94_RS18990 (VXF94_18990) - 3665735..3667405 (-) 1671 WP_014470658.1 DEAD/DEAH box helicase -
  VXF94_RS18995 (VXF94_18995) gcvT 3667829..3668929 (+) 1101 WP_013352857.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=932244 VXF94_RS18980 WP_013352860.1 3664567..3664740(-) (sinI) [Bacillus amyloliquefaciens strain Fad 108]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=932244 VXF94_RS18980 WP_013352860.1 3664567..3664740(-) (sinI) [Bacillus amyloliquefaciens strain Fad 108]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684