Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   V2I11_RS14765 Genome accession   NZ_CP143783
Coordinates   3003698..3003838 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JSZ06     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2998698..3008838
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V2I11_RS14740 - 2999044..2999427 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  V2I11_RS14745 comA 2999449..3000093 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  V2I11_RS14750 comP 3000174..3002474 (-) 2301 WP_032876801.1 histidine kinase Regulator
  V2I11_RS14755 comX 3002488..3002661 (-) 174 WP_012118314.1 competence pheromone ComX -
  V2I11_RS14760 - 3002630..3003490 (-) 861 WP_142925231.1 polyprenyl synthetase family protein -
  V2I11_RS14765 degQ 3003698..3003838 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  V2I11_RS14770 - 3004304..3004645 (+) 342 WP_032876795.1 hypothetical protein -
  V2I11_RS14775 - 3004652..3005875 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  V2I11_RS14780 - 3006005..3007471 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  V2I11_RS14785 - 3007489..3008040 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  V2I11_RS14790 - 3008137..3008535 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=931424 V2I11_RS14765 WP_003152043.1 3003698..3003838(-) (degQ) [Bacillus velezensis strain JSZ06]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=931424 V2I11_RS14765 WP_003152043.1 3003698..3003838(-) (degQ) [Bacillus velezensis strain JSZ06]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891