Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | V2I11_RS14765 | Genome accession | NZ_CP143783 |
| Coordinates | 3003698..3003838 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain JSZ06 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2998698..3008838
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V2I11_RS14740 | - | 2999044..2999427 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| V2I11_RS14745 | comA | 2999449..3000093 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| V2I11_RS14750 | comP | 3000174..3002474 (-) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| V2I11_RS14755 | comX | 3002488..3002661 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| V2I11_RS14760 | - | 3002630..3003490 (-) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| V2I11_RS14765 | degQ | 3003698..3003838 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| V2I11_RS14770 | - | 3004304..3004645 (+) | 342 | WP_032876795.1 | hypothetical protein | - |
| V2I11_RS14775 | - | 3004652..3005875 (-) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| V2I11_RS14780 | - | 3006005..3007471 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| V2I11_RS14785 | - | 3007489..3008040 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| V2I11_RS14790 | - | 3008137..3008535 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=931424 V2I11_RS14765 WP_003152043.1 3003698..3003838(-) (degQ) [Bacillus velezensis strain JSZ06]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=931424 V2I11_RS14765 WP_003152043.1 3003698..3003838(-) (degQ) [Bacillus velezensis strain JSZ06]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |