Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE/blpR   Type   Regulator
Locus tag   ACB344_RS02065 Genome accession   NZ_CP167018
Coordinates   391538..391756 (+) Length   72 a.a.
NCBI ID   WP_011528334.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain Isolate 8     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context


Location: 386538..396756
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACB344_RS02035 (ACB344_02035) - 387547..388122 (+) 576 WP_009880369.1 uracil-DNA glycosylase family protein -
  ACB344_RS02040 (ACB344_02040) ybeY 388281..388778 (+) 498 WP_002985748.1 rRNA maturation RNase YbeY -
  ACB344_RS02045 (ACB344_02045) - 388759..389166 (+) 408 WP_002985746.1 diacylglycerol kinase family protein -
  ACB344_RS02050 (ACB344_02050) era 389286..390182 (+) 897 WP_003047080.1 GTPase Era -
  ACB344_RS02055 (ACB344_02055) - 390202..390678 (+) 477 WP_014635332.1 NUDIX hydrolase -
  ACB344_RS02060 (ACB344_02060) - 390983..391237 (-) 255 WP_010921971.1 hypothetical protein -
  ACB344_RS02065 (ACB344_02065) comE/blpR 391538..391756 (+) 219 WP_011528334.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  ACB344_RS02070 (ACB344_02070) - 391953..393559 (-) 1607 Protein_356 ABC transporter transmembrane domain-containing protein -
  ACB344_RS02075 (ACB344_02075) - 393857..394081 (+) 225 WP_002994580.1 Blp family class II bacteriocin -
  ACB344_RS02080 (ACB344_02080) - 394059..394235 (+) 177 WP_002994581.1 hypothetical protein -
  ACB344_RS02085 (ACB344_02085) - 394559..394840 (+) 282 WP_151412331.1 CPBP family intramembrane glutamic endopeptidase -
  ACB344_RS02090 (ACB344_02090) - 394925..395053 (+) 129 WP_002994583.1 hypothetical protein -
  ACB344_RS02095 (ACB344_02095) - 395451..395678 (+) 228 WP_042769846.1 Blp family class II bacteriocin -
  ACB344_RS02100 (ACB344_02100) - 395727..396044 (+) 318 WP_021299375.1 hypothetical protein -

Sequence


Protein


Download         Length: 72 a.a.        Molecular weight: 8680.16 Da        Isoelectric Point: 10.5045

>NTDB_id=931180 ACB344_RS02065 WP_011528334.1 391538..391756(+) (comE/blpR) [Streptococcus pyogenes strain Isolate 8]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKIYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=931180 ACB344_RS02065 WP_011528334.1 391538..391756(+) (comE/blpR) [Streptococcus pyogenes strain Isolate 8]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGATTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains


Predicted by InterProScan.

(3-56)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417