Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   ACB348_RS07905 Genome accession   NZ_CP167002
Coordinates   1543171..1543389 (-) Length   72 a.a.
NCBI ID   WP_072135532.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain Isolate 30     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 1538171..1548389
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACB348_RS07860 (ACB348_07860) - 1538819..1539136 (-) 318 WP_002994587.1 hypothetical protein -
  ACB348_RS07865 (ACB348_07865) - 1539185..1539412 (-) 228 WP_028797129.1 Blp family class II bacteriocin -
  ACB348_RS07870 (ACB348_07870) - 1539810..1539938 (-) 129 WP_002994583.1 hypothetical protein -
  ACB348_RS07875 (ACB348_07875) - 1540023..1540334 (-) 312 WP_225793061.1 CPBP family intramembrane glutamic endopeptidase -
  ACB348_RS07880 (ACB348_07880) - 1540629..1540805 (-) 177 WP_002994581.1 hypothetical protein -
  ACB348_RS07885 (ACB348_07885) - 1540783..1541007 (-) 225 WP_002994580.1 Blp family class II bacteriocin -
  ACB348_RS07890 (ACB348_07890) comA/nlmT 1541305..1541541 (+) 237 WP_002994577.1 cysteine peptidase family C39 domain-containing protein Regulator
  ACB348_RS07895 (ACB348_07895) - 1541646..1542431 (+) 786 Protein_1501 ABC transporter transmembrane domain-containing protein -
  ACB348_RS07900 (ACB348_07900) comA/nlmT 1542420..1543088 (+) 669 WP_136076166.1 ATP-binding cassette domain-containing protein Regulator
  ACB348_RS07905 (ACB348_07905) comE/blpR 1543171..1543389 (-) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  ACB348_RS07910 (ACB348_07910) - 1543690..1543944 (+) 255 WP_011106868.1 hypothetical protein -
  ACB348_RS07915 (ACB348_07915) - 1544250..1544726 (-) 477 WP_014635332.1 NUDIX hydrolase -
  ACB348_RS07920 (ACB348_07920) era 1544746..1545642 (-) 897 WP_014635331.1 GTPase Era -
  ACB348_RS07925 (ACB348_07925) - 1545762..1546169 (-) 408 WP_002985746.1 diacylglycerol kinase family protein -
  ACB348_RS07930 (ACB348_07930) ybeY 1546150..1546647 (-) 498 WP_111703464.1 rRNA maturation RNase YbeY -
  ACB348_RS07935 (ACB348_07935) - 1546806..1547381 (-) 576 WP_111705183.1 uracil-DNA glycosylase family protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8666.13 Da        Isoelectric Point: 10.5045

>NTDB_id=929806 ACB348_RS07905 WP_072135532.1 1543171..1543389(-) (comE/blpR) [Streptococcus pyogenes strain Isolate 30]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKVYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=929806 ACB348_RS07905 WP_072135532.1 1543171..1543389(-) (comE/blpR) [Streptococcus pyogenes strain Isolate 30]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGGTTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCAAAAAGAAGCAGTTGA

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(3-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417