Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   VRS73_RS13380 Genome accession   NZ_CP142602
Coordinates   2690190..2690366 (+) Length   58 a.a.
NCBI ID   WP_020452165.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain A5     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2685190..2695366
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VRS73_RS13365 (VRS73_13365) gcvT 2685830..2686924 (-) 1095 WP_020452162.1 glycine cleavage system aminomethyltransferase GcvT -
  VRS73_RS13370 (VRS73_13370) - 2687519..2689198 (+) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  VRS73_RS13375 (VRS73_13375) - 2689205..2689999 (+) 795 WP_020452164.1 YqhG family protein -
  VRS73_RS13380 (VRS73_13380) sinI 2690190..2690366 (+) 177 WP_020452165.1 anti-repressor SinI Regulator
  VRS73_RS13385 (VRS73_13385) sinR 2690400..2690735 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  VRS73_RS13390 (VRS73_13390) tasA 2690840..2691634 (-) 795 WP_020452167.1 biofilm matrix protein TasA -
  VRS73_RS13395 (VRS73_13395) sipW 2691707..2692291 (-) 585 WP_020452168.1 signal peptidase I SipW -
  VRS73_RS13400 (VRS73_13400) tapA 2692288..2693016 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  VRS73_RS13405 (VRS73_13405) - 2693294..2693614 (+) 321 WP_020452170.1 YqzG/YhdC family protein -
  VRS73_RS13410 (VRS73_13410) - 2693644..2693826 (-) 183 WP_020452171.1 YqzE family protein -
  VRS73_RS13415 (VRS73_13415) comGG 2693915..2694280 (-) 366 WP_020452172.1 competence type IV pilus minor pilin ComGG -
  VRS73_RS13420 (VRS73_13420) comGF 2694292..2694774 (-) 483 WP_228119627.1 competence type IV pilus minor pilin ComGF -
  VRS73_RS13425 (VRS73_13425) comGE 2694689..2695036 (-) 348 WP_020452174.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6694.49 Da        Isoelectric Point: 5.0637

>NTDB_id=926241 VRS73_RS13380 WP_020452165.1 2690190..2690366(+) (sinI) [Bacillus paralicheniformis strain A5]
MNKDKNEKEELDEEWTELIKHALEQGISPDDIRIFLNLGKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=926241 VRS73_RS13380 WP_020452165.1 2690190..2690366(+) (sinI) [Bacillus paralicheniformis strain A5]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGACGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5