Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | VKP56_RS05730 | Genome accession | NZ_CP142350 |
| Coordinates | 1143695..1143877 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain SS1445 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1143695..1181208 | 1143695..1143877 | within | 0 |
Gene organization within MGE regions
Location: 1143695..1181208
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VKP56_RS05730 (VKP56_05730) | prx | 1143695..1143877 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| VKP56_RS05740 (VKP56_05740) | - | 1144223..1144798 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| VKP56_RS05745 (VKP56_05745) | spek | 1145274..1146053 (-) | 780 | WP_038432391.1 | streptococcal pyrogenic exotoxin SpeK | - |
| VKP56_RS05750 (VKP56_05750) | - | 1146357..1147223 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| VKP56_RS05755 (VKP56_05755) | - | 1147211..1147735 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| VKP56_RS05760 (VKP56_05760) | - | 1147875..1149080 (-) | 1206 | WP_326656676.1 | glucosaminidase domain-containing protein | - |
| VKP56_RS05765 (VKP56_05765) | - | 1149196..1149423 (-) | 228 | WP_000609113.1 | phage holin | - |
| VKP56_RS05770 (VKP56_05770) | - | 1149420..1149692 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| VKP56_RS05775 (VKP56_05775) | - | 1149704..1150315 (-) | 612 | WP_032464454.1 | DUF1366 domain-containing protein | - |
| VKP56_RS05780 (VKP56_05780) | - | 1150318..1150749 (-) | 432 | WP_136107654.1 | DUF1617 family protein | - |
| VKP56_RS05785 (VKP56_05785) | - | 1150758..1152539 (-) | 1782 | WP_136110606.1 | gp58-like family protein | - |
| VKP56_RS05790 (VKP56_05790) | - | 1152554..1153663 (-) | 1110 | WP_159330039.1 | hyaluronoglucosaminidase | - |
| VKP56_RS05795 (VKP56_05795) | - | 1153663..1155621 (-) | 1959 | WP_053308476.1 | phage tail spike protein | - |
| VKP56_RS05800 (VKP56_05800) | - | 1155618..1156313 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| VKP56_RS05805 (VKP56_05805) | - | 1156310..1158667 (-) | 2358 | WP_159330037.1 | hypothetical protein | - |
| VKP56_RS05810 (VKP56_05810) | - | 1158667..1159038 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| VKP56_RS05815 (VKP56_05815) | - | 1159053..1159316 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| VKP56_RS05820 (VKP56_05820) | - | 1159327..1159917 (-) | 591 | WP_053308478.1 | hypothetical protein | - |
| VKP56_RS05825 (VKP56_05825) | - | 1159933..1160268 (-) | 336 | WP_326656677.1 | hypothetical protein | - |
| VKP56_RS05830 (VKP56_05830) | - | 1160269..1160505 (-) | 237 | WP_053308479.1 | hypothetical protein | - |
| VKP56_RS05835 (VKP56_05835) | - | 1160498..1160836 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| VKP56_RS05840 (VKP56_05840) | - | 1160796..1161218 (-) | 423 | WP_109828577.1 | phage Gp19/Gp15/Gp42 family protein | - |
| VKP56_RS05845 (VKP56_05845) | - | 1161239..1161367 (-) | 129 | WP_258296905.1 | hypothetical protein | - |
| VKP56_RS05850 (VKP56_05850) | - | 1161369..1162262 (-) | 894 | WP_053308481.1 | phage major capsid protein | - |
| VKP56_RS05855 (VKP56_05855) | - | 1162266..1162730 (-) | 465 | WP_053308482.1 | DUF4355 domain-containing protein | - |
| VKP56_RS05860 (VKP56_05860) | - | 1162811..1164226 (-) | 1416 | WP_011054685.1 | terminase | - |
| VKP56_RS05865 (VKP56_05865) | - | 1164308..1164544 (-) | 237 | WP_011888764.1 | hypothetical protein | - |
| VKP56_RS05870 (VKP56_05870) | - | 1164546..1164812 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| VKP56_RS05875 (VKP56_05875) | - | 1164805..1164984 (-) | 180 | WP_032461150.1 | hypothetical protein | - |
| VKP56_RS05880 (VKP56_05880) | - | 1165034..1165258 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| VKP56_RS05885 (VKP56_05885) | - | 1165264..1166757 (-) | 1494 | WP_011017978.1 | hypothetical protein | - |
| VKP56_RS05890 (VKP56_05890) | - | 1166750..1168018 (-) | 1269 | WP_011017979.1 | phage portal protein | - |
| VKP56_RS05895 (VKP56_05895) | - | 1168015..1168371 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| VKP56_RS05900 (VKP56_05900) | - | 1168520..1168864 (-) | 345 | WP_063629033.1 | HNH endonuclease signature motif containing protein | - |
| VKP56_RS05905 (VKP56_05905) | - | 1168971..1169390 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| VKP56_RS05910 (VKP56_05910) | - | 1169657..1170292 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| VKP56_RS05915 (VKP56_05915) | - | 1170294..1170578 (-) | 285 | WP_063629032.1 | hypothetical protein | - |
| VKP56_RS05920 (VKP56_05920) | - | 1170565..1170768 (-) | 204 | WP_326656683.1 | hypothetical protein | - |
| VKP56_RS05925 (VKP56_05925) | - | 1170755..1171267 (-) | 513 | WP_029714370.1 | hypothetical protein | - |
| VKP56_RS05930 (VKP56_05930) | - | 1171264..1171605 (-) | 342 | WP_030127594.1 | hypothetical protein | - |
| VKP56_RS05935 (VKP56_05935) | - | 1171782..1172579 (-) | 798 | WP_020837672.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| VKP56_RS05940 (VKP56_05940) | - | 1172572..1172772 (-) | 201 | WP_010922473.1 | hypothetical protein | - |
| VKP56_RS05945 (VKP56_05945) | - | 1172769..1173758 (-) | 990 | WP_010922474.1 | recombinase RecT | - |
| VKP56_RS05950 (VKP56_05950) | - | 1173758..1174090 (-) | 333 | WP_010922475.1 | hypothetical protein | - |
| VKP56_RS05955 (VKP56_05955) | - | 1174146..1174352 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| VKP56_RS05960 (VKP56_05960) | - | 1174361..1174501 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| VKP56_RS05965 (VKP56_05965) | - | 1174498..1174731 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| VKP56_RS05970 (VKP56_05970) | - | 1174712..1175098 (-) | 387 | WP_002990076.1 | DnaD domain-containing protein | - |
| VKP56_RS05975 (VKP56_05975) | - | 1175224..1175493 (-) | 270 | WP_011106700.1 | replication protein | - |
| VKP56_RS05980 (VKP56_05980) | - | 1175587..1175772 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| VKP56_RS05985 (VKP56_05985) | - | 1175774..1176085 (-) | 312 | WP_010922478.1 | excisionase | - |
| VKP56_RS05990 (VKP56_05990) | - | 1176355..1176567 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| VKP56_RS05995 (VKP56_05995) | - | 1176769..1177524 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| VKP56_RS06000 (VKP56_06000) | - | 1177536..1178054 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| VKP56_RS06005 (VKP56_06005) | - | 1178178..1179320 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| VKP56_RS06010 (VKP56_06010) | - | 1179409..1179684 (-) | 276 | WP_111713725.1 | HU family DNA-binding protein | - |
| VKP56_RS06015 (VKP56_06015) | - | 1179783..1180370 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| VKP56_RS06020 (VKP56_06020) | - | 1180348..1181190 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=925004 VKP56_RS05730 WP_011017964.1 1143695..1143877(-) (prx) [Streptococcus pyogenes strain SS1445]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=925004 VKP56_RS05730 WP_011017964.1 1143695..1143877(-) (prx) [Streptococcus pyogenes strain SS1445]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |