Detailed information    

insolico Bioinformatically predicted

Overview

Name   exbB   Type   Machinery gene
Locus tag   VRC24_RS15655 Genome accession   NZ_CP142197
Coordinates   3576533..3577168 (-) Length   211 a.a.
NCBI ID   WP_015372391.1    Uniprot ID   A0A0R2ZS79
Organism   Pseudomonas poae strain B04_4     
Function   ssDNA transport through the inner membrane (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3521439..3579503 3576533..3577168 within 0


Gene organization within MGE regions


Location: 3521439..3579503
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VRC24_RS15310 (VRC24_15310) - 3521439..3522410 (+) 972 WP_060549367.1 LysR family transcriptional regulator -
  VRC24_RS15315 (VRC24_15315) - 3522591..3522776 (-) 186 WP_003232175.1 hypothetical protein -
  VRC24_RS15320 (VRC24_15320) - 3522873..3523202 (-) 330 WP_003232173.1 helix-turn-helix transcriptional regulator -
  VRC24_RS15325 (VRC24_15325) - 3523394..3523528 (+) 135 WP_256094241.1 hypothetical protein -
  VRC24_RS15330 (VRC24_15330) - 3523646..3524104 (-) 459 WP_003232172.1 Hsp20 family protein -
  VRC24_RS15335 (VRC24_15335) - 3524460..3526388 (+) 1929 WP_003232170.1 methyl-accepting chemotaxis protein -
  VRC24_RS15340 (VRC24_15340) - 3527088..3528029 (-) 942 WP_169918359.1 hypothetical protein -
  VRC24_RS15345 (VRC24_15345) - 3528193..3528396 (-) 204 WP_169918360.1 hypothetical protein -
  VRC24_RS15350 (VRC24_15350) - 3528412..3529236 (-) 825 WP_338513262.1 HNH endonuclease signature motif containing protein -
  VRC24_RS15355 (VRC24_15355) - 3529229..3529618 (-) 390 WP_338513263.1 (deoxy)nucleoside triphosphate pyrophosphohydrolase -
  VRC24_RS15360 (VRC24_15360) - 3529993..3530205 (+) 213 WP_043046698.1 hypothetical protein -
  VRC24_RS15365 (VRC24_15365) - 3530629..3532011 (+) 1383 WP_338513264.1 hypothetical protein -
  VRC24_RS15370 (VRC24_15370) umuC 3532225..3533502 (-) 1278 WP_338513265.1 translesion error-prone DNA polymerase V subunit UmuC -
  VRC24_RS15375 (VRC24_15375) - 3533495..3533920 (-) 426 WP_338513266.1 S24 family peptidase -
  VRC24_RS15380 (VRC24_15380) - 3534022..3534717 (+) 696 WP_338513267.1 SOS response-associated peptidase family protein -
  VRC24_RS15385 (VRC24_15385) - 3535583..3536377 (-) 795 WP_069557829.1 DNA adenine methylase -
  VRC24_RS15390 (VRC24_15390) - 3536528..3537070 (-) 543 WP_338513268.1 lysis system i-spanin subunit Rz -
  VRC24_RS15395 (VRC24_15395) - 3537052..3537615 (-) 564 WP_262020343.1 glycoside hydrolase family 19 protein -
  VRC24_RS15400 (VRC24_15400) - 3537664..3538710 (-) 1047 WP_056783387.1 contractile injection system protein, VgrG/Pvc8 family -
  VRC24_RS15405 (VRC24_15405) - 3538804..3539010 (-) 207 WP_338513269.1 tail protein X -
  VRC24_RS15410 (VRC24_15410) - 3538985..3539830 (-) 846 WP_338513270.1 phage tail protein -
  VRC24_RS15415 (VRC24_15415) - 3539840..3542992 (-) 3153 WP_338513271.1 phage tail tape measure protein -
  VRC24_RS15420 (VRC24_15420) - 3543143..3543742 (-) 600 WP_338513272.1 phage tail assembly protein -
  VRC24_RS15425 (VRC24_15425) - 3543757..3544260 (-) 504 WP_098949412.1 phage major tail tube protein -
  VRC24_RS15430 (VRC24_15430) - 3544273..3545439 (-) 1167 WP_338513273.1 phage tail sheath family protein -
  VRC24_RS15435 (VRC24_15435) - 3545542..3545919 (-) 378 WP_338513274.1 phage tail protein -
  VRC24_RS15440 (VRC24_15440) - 3545928..3547811 (-) 1884 WP_338513275.1 phage tail protein -
  VRC24_RS15445 (VRC24_15445) - 3547808..3548497 (-) 690 WP_338513276.1 phage tail protein I -
  VRC24_RS15450 (VRC24_15450) - 3548499..3549380 (-) 882 WP_338513277.1 baseplate J/gp47 family protein -
  VRC24_RS15455 (VRC24_15455) - 3549377..3549703 (-) 327 WP_248132651.1 GPW/gp25 family protein -
  VRC24_RS15460 (VRC24_15460) - 3549709..3549978 (-) 270 WP_338513278.1 hypothetical protein -
  VRC24_RS15465 (VRC24_15465) - 3550036..3550569 (-) 534 WP_338514920.1 phage baseplate assembly protein V -
  VRC24_RS15470 (VRC24_15470) - 3550599..3551114 (-) 516 WP_338513279.1 hypothetical protein -
  VRC24_RS15475 (VRC24_15475) - 3551114..3551773 (-) 660 WP_338513280.1 hypothetical protein -
  VRC24_RS15480 (VRC24_15480) - 3551770..3552090 (-) 321 WP_338513281.1 hypothetical protein -
  VRC24_RS15485 (VRC24_15485) - 3552093..3553088 (-) 996 WP_338513282.1 major capsid protein -
  VRC24_RS15490 (VRC24_15490) - 3553152..3553490 (-) 339 WP_056783424.1 head decoration protein -
  VRC24_RS15495 (VRC24_15495) - 3553487..3554629 (-) 1143 WP_338513283.1 head maturation protease, ClpP-related -
  VRC24_RS15500 (VRC24_15500) - 3554626..3556107 (-) 1482 WP_338513284.1 phage portal protein -
  VRC24_RS15505 (VRC24_15505) - 3556107..3556313 (-) 207 WP_056783432.1 hypothetical protein -
  VRC24_RS15510 (VRC24_15510) - 3556315..3558315 (-) 2001 WP_338513285.1 phage terminase large subunit family protein -
  VRC24_RS15515 (VRC24_15515) - 3558319..3558924 (-) 606 WP_338513286.1 terminase small subunit -
  VRC24_RS15520 (VRC24_15520) - 3559131..3559475 (-) 345 WP_049713155.1 phage holin family protein -
  VRC24_RS15525 (VRC24_15525) - 3559581..3559910 (+) 330 WP_338513287.1 hypothetical protein -
  VRC24_RS15530 (VRC24_15530) - 3560405..3560770 (-) 366 WP_338513288.1 hypothetical protein -
  VRC24_RS15535 (VRC24_15535) - 3560763..3562982 (-) 2220 WP_338514921.1 VapE domain-containing protein -
  VRC24_RS15540 (VRC24_15540) - 3562972..3563199 (-) 228 WP_093126267.1 TraR/DksA family transcriptional regulator -
  VRC24_RS15545 (VRC24_15545) - 3563192..3563710 (-) 519 WP_164487864.1 phage regulatory CII family protein -
  VRC24_RS15550 (VRC24_15550) - 3564035..3564268 (-) 234 WP_338513289.1 hypothetical protein -
  VRC24_RS15555 (VRC24_15555) - 3564367..3565014 (+) 648 WP_338513290.1 S24 family peptidase -
  VRC24_RS15560 (VRC24_15560) - 3565249..3565824 (+) 576 WP_338513291.1 SLATT domain-containing protein -
  VRC24_RS15565 (VRC24_15565) - 3565821..3567182 (+) 1362 WP_338513292.1 reverse transcriptase domain-containing protein -
  VRC24_RS15570 (VRC24_15570) - 3567442..3568023 (+) 582 WP_338513293.1 hypothetical protein -
  VRC24_RS15575 (VRC24_15575) - 3568033..3568317 (+) 285 WP_338513294.1 phage antirepressor KilAC domain-containing protein -
  VRC24_RS15580 (VRC24_15580) - 3568343..3568480 (+) 138 WP_338513295.1 hypothetical protein -
  VRC24_RS15585 (VRC24_15585) - 3568473..3568799 (+) 327 WP_168232324.1 pyocin activator PrtN family protein -
  VRC24_RS15590 (VRC24_15590) - 3568849..3569250 (+) 402 WP_338513296.1 hypothetical protein -
  VRC24_RS15595 (VRC24_15595) - 3569247..3569468 (+) 222 WP_338513297.1 hypothetical protein -
  VRC24_RS15600 (VRC24_15600) - 3569465..3570007 (+) 543 WP_338513298.1 phosphohydrolase -
  VRC24_RS15605 (VRC24_15605) - 3570226..3570500 (+) 275 Protein_3079 DUF4224 domain-containing protein -
  VRC24_RS15610 (VRC24_15610) - 3570502..3571551 (+) 1050 WP_338513299.1 tyrosine-type recombinase/integrase -
  VRC24_RS15620 (VRC24_15620) - 3571911..3572582 (+) 672 WP_003232168.1 Bax inhibitor-1/YccA family protein -
  VRC24_RS15625 (VRC24_15625) murB 3572647..3573666 (-) 1020 WP_338513300.1 UDP-N-acetylmuramate dehydrogenase -
  VRC24_RS15630 (VRC24_15630) - 3573663..3574127 (-) 465 WP_003232164.1 low molecular weight protein-tyrosine-phosphatase -
  VRC24_RS15635 (VRC24_15635) kdsB 3574127..3574891 (-) 765 WP_003232162.1 3-deoxy-manno-octulosonate cytidylyltransferase -
  VRC24_RS15640 (VRC24_15640) - 3574888..3575073 (-) 186 WP_003174668.1 Trm112 family protein -
  VRC24_RS15645 (VRC24_15645) lpxK 3575098..3576108 (-) 1011 WP_169895497.1 tetraacyldisaccharide 4'-kinase -
  VRC24_RS15650 (VRC24_15650) - 3576108..3576536 (-) 429 WP_003232159.1 biopolymer transporter ExbD -
  VRC24_RS15655 (VRC24_15655) exbB 3576533..3577168 (-) 636 WP_015372391.1 MotA/TolQ/ExbB proton channel family protein Machinery gene
  VRC24_RS15660 (VRC24_15660) comA 3577332..3579503 (-) 2172 WP_338513301.1 DNA internalization-related competence protein ComEC/Rec2 Machinery gene

Sequence

Protein


Download         Length: 211 a.a.        Molecular weight: 22998.16 Da        Isoelectric Point: 6.8768

>NTDB_id=923072 VRC24_RS15655 WP_015372391.1 3576533..3577168(-) (exbB) [Pseudomonas poae strain B04_4]
MWELVKSGGWMMLPIILSSIAALGIVAERLWTLRASRVTPEHLLGQVWGWIKNKQLDKQKLKELRANSPLGEILAAGLAN
SKHGREIMKECIEEAAARVIHELERYINALGTIAAMAPLLGLLGTVLGMIDIFSSFMGSGMTTNAAVLAGGISKALITTA
AGLMVGIPSVFFHRFLQRRIDELVVGMEQEAIKLVEVVQGDRDVDLVEDKV

Nucleotide


Download         Length: 636 bp        

>NTDB_id=923072 VRC24_RS15655 WP_015372391.1 3576533..3577168(-) (exbB) [Pseudomonas poae strain B04_4]
GTGTGGGAATTGGTCAAATCCGGTGGTTGGATGATGTTGCCGATCATCTTGAGTTCCATCGCCGCACTCGGCATCGTTGC
CGAACGTCTGTGGACCCTGCGTGCCAGTCGCGTGACCCCCGAGCATCTGCTGGGGCAGGTGTGGGGCTGGATCAAGAACA
AGCAGCTCGACAAACAGAAGCTCAAGGAACTGCGCGCCAATTCGCCCTTGGGAGAAATCCTCGCGGCGGGCCTGGCCAAC
TCCAAGCATGGTCGCGAGATCATGAAAGAATGCATCGAAGAGGCTGCCGCCCGCGTCATTCATGAGCTGGAGCGCTACAT
CAATGCGCTCGGCACCATCGCCGCGATGGCGCCGTTGCTCGGCTTGCTCGGCACCGTGCTGGGCATGATCGATATCTTCA
GCTCGTTCATGGGCTCGGGCATGACCACCAACGCGGCGGTGTTGGCCGGCGGTATCTCCAAAGCCTTGATCACCACCGCA
GCGGGCCTGATGGTGGGTATTCCCTCGGTGTTCTTCCACCGTTTCCTGCAACGGCGCATCGATGAGCTGGTGGTGGGCAT
GGAGCAGGAAGCCATCAAGCTGGTAGAAGTGGTGCAGGGCGACCGTGACGTGGACCTGGTTGAGGACAAGGTGTGA

Domains

Predicted by InterproScan.

MotA/TolQ/ExbB proton channel family (MotA_ExbB)

(66-188)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0R2ZS79

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  exbB Pseudomonas stutzeri DSM 10701

85.714

99.526

0.853