Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   VRB47_RS24415 Genome accession   NZ_CP142184
Coordinates   5435168..5435356 (+) Length   62 a.a.
NCBI ID   WP_338509845.1    Uniprot ID   -
Organism   Pseudomonas poae strain P_poae_W11_9     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Genomic Context


Location: 5430168..5440356
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VRB47_RS24385 (VRB47_24385) - 5430470..5430763 (+) 294 WP_236278041.1 competence protein ComJ -
  VRB47_RS24390 (VRB47_24390) - 5430857..5431937 (+) 1081 Protein_4792 RHS repeat-associated core domain-containing protein -
  VRB47_RS24395 (VRB47_24395) - 5431937..5432296 (+) 360 WP_338502409.1 hypothetical protein -
  VRB47_RS24400 (VRB47_24400) - 5432631..5433737 (+) 1107 Protein_4794 RHS repeat-associated core domain-containing protein -
  VRB47_RS24405 (VRB47_24405) - 5433748..5434155 (+) 408 WP_015373324.1 hypothetical protein -
  VRB47_RS24410 (VRB47_24410) - 5434218..5435000 (+) 783 Protein_4796 RHS repeat-associated core domain-containing protein -
  VRB47_RS24415 (VRB47_24415) nucA/comI 5435168..5435356 (+) 189 WP_338509845.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  VRB47_RS24420 (VRB47_24420) - 5435373..5435987 (+) 615 WP_003231708.1 DUF6707 family protein -
  VRB47_RS24425 (VRB47_24425) - 5436080..5436355 (-) 276 WP_003231709.1 HU family DNA-binding protein -
  VRB47_RS24430 (VRB47_24430) - 5436547..5437695 (-) 1149 WP_065869728.1 FAD-dependent oxidoreductase -
  VRB47_RS24435 (VRB47_24435) - 5437732..5437899 (-) 168 WP_003213373.1 rubredoxin -
  VRB47_RS24440 (VRB47_24440) - 5438094..5438657 (+) 564 WP_065869729.1 chorismate lyase -
  VRB47_RS24445 (VRB47_24445) ubiA 5438657..5439547 (+) 891 WP_003231712.1 4-hydroxybenzoate octaprenyltransferase -
  VRB47_RS24450 (VRB47_24450) - 5439646..5440023 (-) 378 WP_003231713.1 hypothetical protein -

Sequence


Protein


Download         Length: 62 a.a.        Molecular weight: 6593.47 Da        Isoelectric Point: 8.5910

>NTDB_id=922826 VRB47_RS24415 WP_338509845.1 5435168..5435356(+) (nucA/comI) [Pseudomonas poae strain P_poae_W11_9]
MAGHPSVKALDRDEFPMAMFKEGGKGASVRYIDPSDNRGAGSSIAHVLSGYDDGTRVKIVVK

Nucleotide


Download         Length: 189 bp        

>NTDB_id=922826 VRB47_RS24415 WP_338509845.1 5435168..5435356(+) (nucA/comI) [Pseudomonas poae strain P_poae_W11_9]
CTGGCCGGTCACCCGTCCGTCAAGGCACTGGACCGGGATGAATTCCCGATGGCGATGTTCAAAGAAGGTGGCAAAGGGGC
TAGCGTCAGGTACATCGACCCTAGCGACAACCGAGGCGCAGGCTCCTCGATCGCGCATGTCCTGAGCGGCTATGACGACG
GGACCCGAGTAAAAATAGTCGTGAAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.069

93.548

0.581