Detailed information    

insolico Bioinformatically predicted

Overview


Name   amiF   Type   Regulator
Locus tag   VRA41_RS06640 Genome accession   NZ_CP142105
Coordinates   1271340..1272269 (-) Length   309 a.a.
NCBI ID   WP_002951426.1    Uniprot ID   A0A7U7CIU5
Organism   Streptococcus thermophilus strain SCB0351     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1255806..1327579 1271340..1272269 within 0


Gene organization within MGE regions


Location: 1255806..1327579
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VRA41_RS06565 (VRA41_06565) liaF 1255814..1256512 (-) 699 WP_011227403.1 cell wall-active antibiotics response protein LiaF -
  VRA41_RS06570 (VRA41_06570) - 1256778..1256933 (-) 156 WP_011226290.1 ion channel -
  VRA41_RS06575 (VRA41_06575) stkP/pknB 1257570..1259441 (-) 1872 WP_011226292.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  VRA41_RS06580 (VRA41_06580) - 1259441..1260178 (-) 738 WP_002946881.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  VRA41_RS06585 (VRA41_06585) rsmB 1260222..1261544 (-) 1323 WP_014608533.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  VRA41_RS06590 (VRA41_06590) fmt 1261534..1262469 (-) 936 WP_002951411.1 methionyl-tRNA formyltransferase -
  VRA41_RS06595 (VRA41_06595) - 1262487..1264883 (-) 2397 WP_011227404.1 primosomal protein N' -
  VRA41_RS06600 (VRA41_06600) rpoZ 1265025..1265339 (-) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  VRA41_RS06605 (VRA41_06605) gmk 1265361..1265990 (-) 630 WP_011226296.1 guanylate kinase -
  VRA41_RS06610 (VRA41_06610) ftsY 1266223..1267614 (-) 1392 WP_011226297.1 signal recognition particle-docking protein FtsY -
  VRA41_RS06615 (VRA41_06615) - 1267628..1268443 (-) 816 WP_011227405.1 Cof-type HAD-IIB family hydrolase -
  VRA41_RS06620 (VRA41_06620) - 1268436..1269230 (-) 795 WP_011227406.1 HAD hydrolase family protein -
  VRA41_RS06625 (VRA41_06625) - 1269413..1269790 (+) 378 WP_011226300.1 GntR family transcriptional regulator -
  VRA41_RS06630 (VRA41_06630) - 1269795..1270493 (+) 699 WP_011226301.1 ABC transporter ATP-binding protein -
  VRA41_RS06635 (VRA41_06635) - 1270505..1271290 (+) 786 WP_002951425.1 hypothetical protein -
  VRA41_RS06640 (VRA41_06640) amiF 1271340..1272269 (-) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  VRA41_RS06645 (VRA41_06645) amiE 1272262..1273347 (-) 1086 WP_011226304.1 ABC transporter ATP-binding protein Regulator
  VRA41_RS06650 (VRA41_06650) amiD 1273357..1274283 (-) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  VRA41_RS06655 (VRA41_06655) amiC 1274283..1275776 (-) 1494 WP_011227407.1 ABC transporter permease Regulator
  VRA41_RS06660 (VRA41_06660) amiA 1275838..1277805 (-) 1968 WP_011226784.1 peptide ABC transporter substrate-binding protein Regulator
  VRA41_RS06665 (VRA41_06665) - 1278161..1279410 (+) 1250 Protein_1269 ISL3 family transposase -
  VRA41_RS06670 (VRA41_06670) amiA3 1279455..1281422 (-) 1968 WP_011227411.1 peptide ABC transporter substrate-binding protein Regulator
  VRA41_RS06675 (VRA41_06675) - 1281626..1281816 (-) 191 Protein_1271 IS3 family transposase -
  VRA41_RS06680 (VRA41_06680) - 1281810..1282220 (-) 411 Protein_1272 ATP-binding cassette domain-containing protein -
  VRA41_RS06685 (VRA41_06685) - 1282252..1282566 (-) 315 Protein_1273 TatD family hydrolase -
  VRA41_RS06690 (VRA41_06690) - 1282915..1284120 (+) 1206 WP_011227415.1 OFA family MFS transporter -
  VRA41_RS06695 (VRA41_06695) - 1284166..1285518 (-) 1353 Protein_1275 IS3 family transposase -
  VRA41_RS06700 (VRA41_06700) pta 1285604..1286587 (-) 984 WP_011227420.1 phosphate acetyltransferase -
  VRA41_RS06705 (VRA41_06705) - 1286601..1287497 (-) 897 WP_011226316.1 RluA family pseudouridine synthase -
  VRA41_RS06710 (VRA41_06710) - 1287494..1288330 (-) 837 WP_041827075.1 NAD kinase -
  VRA41_RS06715 (VRA41_06715) - 1288302..1288976 (-) 675 WP_002951443.1 GTP pyrophosphokinase family protein -
  VRA41_RS06720 (VRA41_06720) - 1289072..1289647 (+) 576 WP_002951444.1 CYTH domain-containing protein -
  VRA41_RS06725 (VRA41_06725) - 1290010..1290981 (+) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  VRA41_RS06730 (VRA41_06730) - 1290985..1292097 (+) 1113 WP_002948029.1 cysteine desulfurase family protein -
  VRA41_RS06735 (VRA41_06735) - 1292099..1292446 (+) 348 WP_002948028.1 DUF1831 domain-containing protein -
  VRA41_RS06740 (VRA41_06740) - 1292590..1293249 (+) 660 WP_041827076.1 redox-sensing transcriptional repressor Rex -
  VRA41_RS06745 (VRA41_06745) - 1293242..1293937 (+) 696 WP_011227423.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  VRA41_RS06750 (VRA41_06750) radC 1293990..1294676 (-) 687 WP_011227424.1 RadC family protein -
  VRA41_RS06755 (VRA41_06755) - 1294855..1296195 (-) 1341 WP_231108743.1 DUF2142 domain-containing protein -
  VRA41_RS06760 (VRA41_06760) - 1296344..1298089 (-) 1746 WP_011227426.1 rhamnan synthesis F family protein -
  VRA41_RS06765 (VRA41_06765) - 1298091..1299791 (-) 1701 WP_041827077.1 glycosyltransferase family 4 protein -
  VRA41_RS06770 (VRA41_06770) - 1299809..1301011 (-) 1203 WP_011227428.1 ABC transporter ATP-binding protein -
  VRA41_RS06775 (VRA41_06775) - 1301011..1301817 (-) 807 WP_011227429.1 ABC transporter permease -
  VRA41_RS06780 (VRA41_06780) - 1301817..1302758 (-) 942 WP_011227430.1 glycosyltransferase family 2 protein -
  VRA41_RS06785 (VRA41_06785) cps2T 1302755..1303903 (-) 1149 WP_011227431.1 beta 1-4 rhamnosyltransferase Cps2T -
  VRA41_RS06790 (VRA41_06790) - 1304022..1304804 (-) 783 WP_011227432.1 glycosyltransferase family A protein -
  VRA41_RS06795 (VRA41_06795) - 1304805..1305137 (-) 333 WP_011227433.1 DUF2304 domain-containing protein -
  VRA41_RS06800 (VRA41_06800) - 1305143..1305838 (-) 696 WP_173405413.1 glycosyltransferase family 2 protein -
  VRA41_RS06805 (VRA41_06805) - 1305922..1306394 (-) 473 Protein_1297 glycosyltransferase family 2 protein -
  VRA41_RS06810 (VRA41_06810) - 1306459..1307445 (-) 987 WP_011227437.1 glycosyltransferase family 2 protein -
  VRA41_RS06815 (VRA41_06815) - 1307442..1308701 (-) 1260 WP_011227438.1 oligosaccharide flippase family protein -
  VRA41_RS06820 (VRA41_06820) rfbD 1308822..1309673 (-) 852 WP_014621820.1 dTDP-4-dehydrorhamnose reductase -
  VRA41_RS06825 (VRA41_06825) - 1309791..1310717 (-) 927 WP_011227439.1 glycosyltransferase family 2 protein -
  VRA41_RS06830 (VRA41_06830) - 1310727..1311062 (-) 336 WP_002891474.1 metal-sulfur cluster assembly factor -
  VRA41_RS06835 (VRA41_06835) rpoD 1311116..1312225 (-) 1110 WP_011227440.1 RNA polymerase sigma factor RpoD -
  VRA41_RS06840 (VRA41_06840) dnaG 1312229..1314040 (-) 1812 WP_011227441.1 DNA primase -
  VRA41_RS06845 (VRA41_06845) rpsU 1314412..1314588 (-) 177 WP_011226340.1 30S ribosomal protein S21 -
  VRA41_RS06850 (VRA41_06850) - 1314969..1315922 (+) 954 WP_041826943.1 IS30 family transposase -
  VRA41_RS06855 (VRA41_06855) - 1316028..1316822 (-) 795 WP_011227442.1 ABC transporter substrate-binding protein -
  VRA41_RS06860 (VRA41_06860) - 1316915..1318024 (-) 1110 WP_041827078.1 aminotransferase -
  VRA41_RS06865 (VRA41_06865) - 1318371..1319168 (-) 798 WP_059257394.1 transporter substrate-binding domain-containing protein -
  VRA41_RS06870 (VRA41_06870) - 1319165..1319995 (-) 831 WP_041828297.1 transporter substrate-binding domain-containing protein -
  VRA41_RS06875 (VRA41_06875) - 1320209..1320673 (-) 465 WP_011226345.1 8-oxo-dGTP diphosphatase -
  VRA41_RS06880 (VRA41_06880) uvrB 1320718..1322709 (-) 1992 WP_002953358.1 excinuclease ABC subunit UvrB -
  VRA41_RS06885 (VRA41_06885) - 1323396..1324332 (-) 937 Protein_1313 CPBP family intramembrane glutamic endopeptidase -
  VRA41_RS06890 (VRA41_06890) - 1324531..1326741 (+) 2211 WP_326024624.1 ABC transporter substrate-binding protein/permease -
  VRA41_RS06895 (VRA41_06895) - 1326741..1327481 (+) 741 WP_002945131.1 amino acid ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 309 a.a.        Molecular weight: 35171.28 Da        Isoelectric Point: 6.5989

>NTDB_id=921682 VRA41_RS06640 WP_002951426.1 1271340..1272269(-) (amiF) [Streptococcus thermophilus strain SCB0351]
MPEKLVEVKDVEISFGEGRKKFVAVHNANFFINKGETFSLVGESGSGKTTIGRAIIGLNDTSNGEIIFDGKKINGYLSHS
EKNDLIRRIQMIFQDPAASLNERATVDYILSEGLYNFHLYKDEEERKAKIKEIIKEVGLLEEHLTRYPHEFSGGQRQRIG
IARSLVMQPDLVIADEPISALDVSVRAQVLNLLKKFQKELGLTYLFIAHDLSVVRFISDRIAVIYKGTIVEVAETEELYN
NPIHPYTKSLLSAVPIPDPILERKKVLKVYDPNQHDYSVDKPEMVEVRPGHFVWGNKTEIETYRKEQSK

Nucleotide


Download         Length: 930 bp        

>NTDB_id=921682 VRA41_RS06640 WP_002951426.1 1271340..1272269(-) (amiF) [Streptococcus thermophilus strain SCB0351]
ATGCCTGAGAAATTAGTTGAAGTAAAAGATGTGGAAATTTCCTTCGGCGAAGGAAGAAAGAAGTTCGTTGCTGTCCACAA
TGCTAATTTTTTCATCAACAAGGGTGAAACCTTCTCCCTCGTTGGTGAGTCTGGTAGTGGTAAAACGACTATTGGACGTG
CCATTATCGGTTTAAATGACACAAGTAATGGTGAGATTATTTTTGACGGTAAGAAGATCAATGGATACTTATCTCACTCT
GAGAAAAACGACCTTATCCGTCGTATTCAGATGATTTTCCAAGACCCTGCGGCTAGTTTGAATGAACGTGCGACAGTCGA
TTATATCTTGTCTGAGGGCTTGTACAATTTCCATCTTTATAAAGATGAGGAAGAACGTAAGGCTAAAATCAAGGAAATCA
TCAAAGAAGTAGGACTTCTTGAGGAGCACTTAACACGTTACCCTCACGAATTTTCTGGGGGACAACGTCAACGTATCGGG
ATTGCGCGTTCTTTGGTCATGCAGCCTGATTTGGTTATCGCTGATGAACCAATCTCAGCCCTTGACGTGTCAGTTCGTGC
CCAAGTTTTGAATTTGCTTAAGAAATTCCAAAAAGAGTTGGGGTTAACCTATCTCTTTATCGCTCACGATTTGTCAGTGG
TCCGTTTCATTTCTGACCGTATCGCTGTTATCTATAAGGGGACAATCGTGGAAGTTGCTGAGACAGAAGAGCTCTACAAC
AATCCTATCCATCCTTACACCAAGTCACTCTTGTCTGCTGTTCCTATTCCAGATCCAATCTTGGAACGTAAGAAAGTCTT
GAAGGTTTATGATCCAAACCAACACGACTATTCGGTTGATAAACCAGAAATGGTGGAAGTACGCCCAGGTCACTTCGTTT
GGGGTAACAAGACAGAAATTGAGACTTATCGTAAAGAACAAAGTAAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7U7CIU5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiF Streptococcus thermophilus LMG 18311

100

100

1

  amiF Streptococcus thermophilus LMD-9

99.676

100

0.997

  amiF Streptococcus salivarius strain HSISS4

98.058

100

0.981