Detailed information NTG0920990

Bioinformatically predicted

Overview

• Name: comS
• Type: Regulator
• Locus tag: VOI49_RS00380
• Genome accession: NZ_CP142018
• Coordinates: 59518..59616 (+)
• Length: 32 a.a.
• NCBI ID: WP_014611913.1
• Uniprot ID: A0A380JYX6
• Organism: Streptococcus dysgalactiae strain lu24
• Function: activate transcription of comX (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	58165..59253	59518..59616	flank	265

Gene organization within MGE regions

Location: 58165..59616

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
VOI49_RS00375	-	58165..59340 (-)	1176	WP_243093136.1	IS256 family transposase	-
VOI49_RS00380	comS	59518..59616 (+)	99	WP_014611913.1	quorum-sensing system DWW-type pheromone	Regulator

Sequence

Protein

• Length: 32 a.a.
• Molecular weight: 3771.59 Da
• Isoelectric Point: 10.4764

>NTDB_id=920990 VOI49_RS00380 WP_014611913.1 59518..59616(+) (comS) [Streptococcus dysgalactiae strain lu24]
MFKKIKPYLLLAAVVAFKVARAMNEFDWWNLG

Nucleotide

• Length: 99 bp

>NTDB_id=920990 VOI49_RS00380 WP_014611913.1 59518..59616(+) (comS) [Streptococcus dysgalactiae strain lu24]
ATGTTTAAAAAAATCAAACCATATTTGTTATTAGCTGCAGTCGTTGCTTTCAAAGTTGCTCGTGCAATGAACGAATTTGA
TTGGTGGAACCTAGGGTGA

Domains

No domain identified.

3D structure

• AlphaFold DB: A0A380JYX6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comS	Streptococcus pyogenes MGAS315	84.375	100	0.844
comS	Streptococcus pyogenes MGAS8232	45.161	96.875	0.437