Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   VDS57_RS00480 Genome accession   NZ_CP141839
Coordinates   89763..89936 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain PN1236     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 84763..94936
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VDS57_RS00465 (VDS57_00465) gcvT 85562..86650 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  VDS57_RS00470 (VDS57_00470) hepAA 87092..88765 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  VDS57_RS00475 (VDS57_00475) yqhG 88786..89580 (+) 795 WP_014480249.1 YqhG family protein -
  VDS57_RS00480 (VDS57_00480) sinI 89763..89936 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  VDS57_RS00485 (VDS57_00485) sinR 89970..90305 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  VDS57_RS00490 (VDS57_00490) tasA 90398..91183 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  VDS57_RS00495 (VDS57_00495) sipW 91247..91819 (-) 573 WP_003230181.1 signal peptidase I SipW -
  VDS57_RS00500 (VDS57_00500) tapA 91803..92564 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  VDS57_RS00505 (VDS57_00505) yqzG 92836..93162 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  VDS57_RS00510 (VDS57_00510) spoIITA 93204..93383 (-) 180 WP_014480252.1 YqzE family protein -
  VDS57_RS00515 (VDS57_00515) comGG 93462..93827 (-) 366 WP_324271587.1 ComG operon protein ComGG Machinery gene
  VDS57_RS00520 (VDS57_00520) comGF 93828..94211 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  VDS57_RS00525 (VDS57_00525) comGE 94237..94584 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=920109 VDS57_RS00480 WP_003230187.1 89763..89936(+) (sinI) [Bacillus subtilis strain PN1236]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=920109 VDS57_RS00480 WP_003230187.1 89763..89936(+) (sinI) [Bacillus subtilis strain PN1236]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1