Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   VO177_RS12205 Genome accession   NZ_CP141828
Coordinates   2378995..2379168 (-) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain TZS01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2373995..2384168
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VO177_RS12155 (VO177_12155) comGD 2374114..2374551 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  VO177_RS12160 (VO177_12160) comGE 2374535..2374849 (+) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  VO177_RS12165 (VO177_12165) comGF 2374863..2375258 (+) 396 WP_021494311.1 competence type IV pilus minor pilin ComGF -
  VO177_RS12170 (VO177_12170) comGG 2375259..2375636 (+) 378 WP_021494310.1 competence type IV pilus minor pilin ComGG Machinery gene
  VO177_RS12175 (VO177_12175) - 2375693..2375872 (+) 180 WP_003153093.1 YqzE family protein -
  VO177_RS12180 (VO177_12180) - 2375913..2376242 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  VO177_RS12185 (VO177_12185) tapA 2376501..2377172 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  VO177_RS12190 (VO177_12190) sipW 2377144..2377728 (+) 585 WP_012117977.1 signal peptidase I SipW -
  VO177_RS12195 (VO177_12195) tasA 2377793..2378578 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  VO177_RS12200 (VO177_12200) sinR 2378626..2378961 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  VO177_RS12205 (VO177_12205) sinI 2378995..2379168 (-) 174 WP_014418369.1 anti-repressor SinI Regulator
  VO177_RS12210 (VO177_12210) - 2379345..2380139 (-) 795 WP_014418368.1 YqhG family protein -
  VO177_RS12215 (VO177_12215) - 2380161..2381831 (-) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  VO177_RS12220 (VO177_12220) gcvT 2382255..2383355 (+) 1101 WP_021494308.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=919978 VO177_RS12205 WP_014418369.1 2378995..2379168(-) (sinI) [Bacillus velezensis strain TZS01]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=919978 VO177_RS12205 WP_014418369.1 2378995..2379168(-) (sinI) [Bacillus velezensis strain TZS01]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719