Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   VO177_RS12150 Genome accession   NZ_CP141828
Coordinates   2373858..2374124 (+) Length   88 a.a.
NCBI ID   WP_050496152.1    Uniprot ID   -
Organism   Bacillus velezensis strain TZS01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2368858..2379124
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VO177_RS12130 (VO177_12130) - 2369127..2370428 (-) 1302 WP_021494315.1 hemolysin family protein -
  VO177_RS12135 (VO177_12135) - 2370574..2371524 (+) 951 WP_014418379.1 magnesium transporter CorA family protein -
  VO177_RS12140 (VO177_12140) comGA 2371717..2372787 (+) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  VO177_RS12145 (VO177_12145) comGB 2372774..2373811 (+) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  VO177_RS12150 (VO177_12150) comGC 2373858..2374124 (+) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  VO177_RS12155 (VO177_12155) comGD 2374114..2374551 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  VO177_RS12160 (VO177_12160) comGE 2374535..2374849 (+) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  VO177_RS12165 (VO177_12165) comGF 2374863..2375258 (+) 396 WP_021494311.1 competence type IV pilus minor pilin ComGF -
  VO177_RS12170 (VO177_12170) comGG 2375259..2375636 (+) 378 WP_021494310.1 competence type IV pilus minor pilin ComGG Machinery gene
  VO177_RS12175 (VO177_12175) - 2375693..2375872 (+) 180 WP_003153093.1 YqzE family protein -
  VO177_RS12180 (VO177_12180) - 2375913..2376242 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  VO177_RS12185 (VO177_12185) tapA 2376501..2377172 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  VO177_RS12190 (VO177_12190) sipW 2377144..2377728 (+) 585 WP_012117977.1 signal peptidase I SipW -
  VO177_RS12195 (VO177_12195) tasA 2377793..2378578 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  VO177_RS12200 (VO177_12200) sinR 2378626..2378961 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9740.36 Da        Isoelectric Point: 6.4456

>NTDB_id=919973 VO177_RS12150 WP_050496152.1 2373858..2374124(+) (comGC) [Bacillus velezensis strain TZS01]
MLIVLFIVSILLLITIPNVTKHNQSIQRKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=919973 VO177_RS12150 WP_050496152.1 2373858..2374124(+) (comGC) [Bacillus velezensis strain TZS01]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCGTAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGTCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

73.611

81.818

0.602