Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   VO179_RS05185 Genome accession   NZ_CP141827
Coordinates   1190960..1191133 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain XHA14     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1185960..1196133
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VO179_RS05170 (VO179_05170) gcvT 1186773..1187873 (-) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -
  VO179_RS05175 (VO179_05175) - 1188297..1189967 (+) 1671 WP_031378948.1 DEAD/DEAH box helicase -
  VO179_RS05180 (VO179_05180) - 1189989..1190783 (+) 795 WP_156240427.1 YqhG family protein -
  VO179_RS05185 (VO179_05185) sinI 1190960..1191133 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  VO179_RS05190 (VO179_05190) sinR 1191167..1191502 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  VO179_RS05195 (VO179_05195) tasA 1191550..1192335 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  VO179_RS05200 (VO179_05200) sipW 1192400..1192984 (-) 585 WP_015240205.1 signal peptidase I SipW -
  VO179_RS05205 (VO179_05205) tapA 1192956..1193627 (-) 672 WP_324636720.1 amyloid fiber anchoring/assembly protein TapA -
  VO179_RS05210 (VO179_05210) - 1193886..1194215 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  VO179_RS05215 (VO179_05215) - 1194255..1194434 (-) 180 WP_003153093.1 YqzE family protein -
  VO179_RS05220 (VO179_05220) comGG 1194491..1194868 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  VO179_RS05225 (VO179_05225) comGF 1194869..1195264 (-) 396 WP_324636718.1 competence type IV pilus minor pilin ComGF -
  VO179_RS05230 (VO179_05230) comGE 1195278..1195592 (-) 315 WP_324636717.1 competence type IV pilus minor pilin ComGE -
  VO179_RS05235 (VO179_05235) comGD 1195576..1196013 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=919869 VO179_RS05185 WP_003153105.1 1190960..1191133(+) (sinI) [Bacillus velezensis strain XHA14]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=919869 VO179_RS05185 WP_003153105.1 1190960..1191133(+) (sinI) [Bacillus velezensis strain XHA14]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702