Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AB1F75_RS08625 Genome accession   NZ_CP160396
Coordinates   1648570..1648743 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis subsp. subtilis strain BSP1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1643570..1653743
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB1F75_RS08580 (AB1F75_08580) comGE 1643920..1644267 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  AB1F75_RS08585 (AB1F75_08585) comGF 1644293..1644676 (+) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  AB1F75_RS08590 (AB1F75_08590) comGG 1644677..1645051 (+) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  AB1F75_RS08595 (AB1F75_08595) spoIITA 1645122..1645302 (+) 181 Protein_1684 YqzE family protein -
  AB1F75_RS08600 (AB1F75_08600) yqzG 1645344..1645670 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB1F75_RS08605 (AB1F75_08605) tapA 1645942..1646703 (+) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  AB1F75_RS08610 (AB1F75_08610) sipW 1646687..1647259 (+) 573 WP_003246088.1 signal peptidase I SipW -
  AB1F75_RS08615 (AB1F75_08615) tasA 1647323..1648108 (+) 786 WP_015251717.1 biofilm matrix protein TasA -
  AB1F75_RS08620 (AB1F75_08620) sinR 1648201..1648536 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB1F75_RS08625 (AB1F75_08625) sinI 1648570..1648743 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB1F75_RS08630 (AB1F75_08630) yqhG 1648926..1649720 (-) 795 WP_003230200.1 YqhG family protein -
  AB1F75_RS08635 (AB1F75_08635) hepAA 1649741..1651413 (-) 1673 Protein_1692 SNF2-related protein -
  AB1F75_RS08640 (AB1F75_08640) gcvT 1651855..1652943 (+) 1089 WP_015251720.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=918154 AB1F75_RS08625 WP_003230187.1 1648570..1648743(-) (sinI) [Bacillus subtilis subsp. subtilis strain BSP1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=918154 AB1F75_RS08625 WP_003230187.1 1648570..1648743(-) (sinI) [Bacillus subtilis subsp. subtilis strain BSP1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1