Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   AB1F71_RS02095 Genome accession   NZ_CP160386
Coordinates   395207..395437 (+) Length   76 a.a.
NCBI ID   WP_002275977.1    Uniprot ID   Q8DVP7
Organism   Streptococcus mutans strain UA159 ykuR deletion     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 390207..400437
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB1F71_RS02075 (AB1F71_02075) - 390776..391072 (+) 297 WP_002263922.1 YlxR family protein -
  AB1F71_RS02080 (AB1F71_02080) - 391065..391367 (+) 303 WP_002262601.1 YlxQ-related RNA-binding protein -
  AB1F71_RS02085 (AB1F71_02085) infB 391388..394138 (+) 2751 WP_002262600.1 translation initiation factor IF-2 -
  AB1F71_RS02090 (AB1F71_02090) rbfA 394372..394722 (+) 351 WP_002262599.1 30S ribosome-binding factor RbfA -
  AB1F71_RS02095 (AB1F71_02095) cipB 395207..395437 (+) 231 WP_002275977.1 bacteriocin class II family protein Regulator
  AB1F71_RS02100 (AB1F71_02100) - 395828..396271 (+) 444 WP_002263708.1 CopY/TcrY family copper transport repressor -
  AB1F71_RS02105 (AB1F71_02105) - 396268..398496 (+) 2229 WP_002263707.1 heavy metal translocating P-type ATPase -
  AB1F71_RS02110 (AB1F71_02110) copZ 398509..398712 (+) 204 WP_002263706.1 copper chaperone CopZ -
  AB1F71_RS02115 (AB1F71_02115) - 398959..399780 (+) 822 WP_032497569.1 Cof-type HAD-IIB family hydrolase -
  AB1F71_RS02120 (AB1F71_02120) - 399887..400378 (-) 492 WP_011074508.1 YgjV family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7229.19 Da        Isoelectric Point: 3.7781

>NTDB_id=917989 AB1F71_RS02095 WP_002275977.1 395207..395437(+) (cipB) [Streptococcus mutans strain UA159 ykuR deletion]
MNTQAFEQFNVMDNEALSTVEGGGMIRCALGTAGSAGLGFVGGMGAGTVTLPVVGTVSGAALGGWSGAAVGAATFC

Nucleotide


Download         Length: 231 bp        

>NTDB_id=917989 AB1F71_RS02095 WP_002275977.1 395207..395437(+) (cipB) [Streptococcus mutans strain UA159 ykuR deletion]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAACTGTTGAGGGTGGTGGTATGATTAG
ATGTGCACTTGGCACAGCTGGTTCTGCAGGTTTAGGATTTGTAGGGGGTATGGGAGCTGGTACAGTTACTCTCCCAGTCG
TTGGTACAGTATCTGGAGCGGCTTTAGGAGGCTGGTCTGGAGCAGCTGTAGGTGCTGCTACTTTTTGTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DVP7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

71.429

55.263

0.395