Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   U7118_RS09730 Genome accession   NZ_CP141283
Coordinates   1799660..1799833 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain DKU_09     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1794660..1804833
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U7118_RS09685 (U7118_09685) comGE 1795012..1795359 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  U7118_RS09690 (U7118_09690) comGF 1795385..1795768 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  U7118_RS09695 (U7118_09695) comGG 1795769..1796134 (+) 366 WP_324271587.1 ComG operon protein ComGG Machinery gene
  U7118_RS09700 (U7118_09700) spoIITA 1796213..1796392 (+) 180 WP_014480252.1 YqzE family protein -
  U7118_RS09705 (U7118_09705) yqzG 1796434..1796760 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  U7118_RS09710 (U7118_09710) tapA 1797032..1797793 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  U7118_RS09715 (U7118_09715) sipW 1797777..1798349 (+) 573 WP_003230181.1 signal peptidase I SipW -
  U7118_RS09720 (U7118_09720) tasA 1798413..1799198 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  U7118_RS09725 (U7118_09725) sinR 1799291..1799626 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  U7118_RS09730 (U7118_09730) sinI 1799660..1799833 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  U7118_RS09735 (U7118_09735) yqhG 1800016..1800810 (-) 795 WP_014480249.1 YqhG family protein -
  U7118_RS09740 (U7118_09740) hepAA 1800831..1802504 (-) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  U7118_RS09745 (U7118_09745) gcvT 1802946..1804034 (+) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=916825 U7118_RS09730 WP_003230187.1 1799660..1799833(-) (sinI) [Bacillus subtilis strain DKU_09]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=916825 U7118_RS09730 WP_003230187.1 1799660..1799833(-) (sinI) [Bacillus subtilis strain DKU_09]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1