Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ABXV02_RS05880 Genome accession   NZ_CP159912
Coordinates   1122924..1123064 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain PY79     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1117924..1128064
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABXV02_RS05850 yueI 1118219..1118617 (+) 399 WP_003242987.1 YueI family protein -
  ABXV02_RS05855 pncA 1118714..1119265 (+) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  ABXV02_RS05860 pncB 1119281..1120753 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ABXV02_RS05865 pdeH 1120890..1122119 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ABXV02_RS05870 - 1122095..1122463 (-) 369 WP_003243784.1 hypothetical protein -
  ABXV02_RS05875 - 1122577..1122702 (-) 126 WP_003228793.1 hypothetical protein -
  ABXV02_RS05880 degQ 1122924..1123064 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ABXV02_RS05885 comQ 1123249..1124148 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ABXV02_RS05890 comX 1124136..1124303 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  ABXV02_RS05895 comP 1124318..1126627 (+) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  ABXV02_RS05900 comA 1126708..1127352 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ABXV02_RS05905 yuxO 1127371..1127751 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=915942 ABXV02_RS05880 WP_003220708.1 1122924..1123064(+) (degQ) [Bacillus subtilis strain PY79]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=915942 ABXV02_RS05880 WP_003220708.1 1122924..1123064(+) (degQ) [Bacillus subtilis strain PY79]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1