Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   ABYM97_RS19850 Genome accession   NZ_CP159874
Coordinates   3811231..3811398 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis strain PY79     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3806231..3816398
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABYM97_RS19820 (ABYM97_19820) mrpE 3806626..3807102 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  ABYM97_RS19825 (ABYM97_19825) mrpF 3807102..3807386 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  ABYM97_RS19830 (ABYM97_19830) mnhG 3807370..3807744 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  ABYM97_RS19835 (ABYM97_19835) yuxO 3807783..3808163 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ABYM97_RS19840 (ABYM97_19840) comA 3808182..3808826 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ABYM97_RS19845 (ABYM97_19845) comP 3808907..3811216 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  ABYM97_RS19850 (ABYM97_19850) comX 3811231..3811398 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ABYM97_RS19855 (ABYM97_19855) comQ 3811386..3812285 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ABYM97_RS19860 (ABYM97_19860) degQ 3812470..3812610 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ABYM97_RS19865 (ABYM97_19865) - 3812832..3812957 (+) 126 WP_003228793.1 hypothetical protein -
  ABYM97_RS19870 (ABYM97_19870) - 3813071..3813439 (+) 369 WP_003243784.1 hypothetical protein -
  ABYM97_RS19875 (ABYM97_19875) pdeH 3813415..3814644 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ABYM97_RS19880 (ABYM97_19880) pncB 3814781..3816253 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=915337 ABYM97_RS19850 WP_003242801.1 3811231..3811398(-) (comX) [Bacillus subtilis strain PY79]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=915337 ABYM97_RS19850 WP_003242801.1 3811231..3811398(-) (comX) [Bacillus subtilis strain PY79]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1