Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   L6430_RS01695 Genome accession   NZ_AP025342
Coordinates   314152..314292 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain J41TS8     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 309152..319292
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L6430_RS01670 - 309445..309834 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  L6430_RS01675 comA 309851..310489 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  L6430_RS01680 comP 310576..312891 (-) 2316 WP_020452789.1 sensor histidine kinase Regulator
  L6430_RS01685 comX 312912..313082 (-) 171 WP_020452790.1 competence pheromone ComX -
  L6430_RS01690 - 313054..313965 (-) 912 WP_020452791.1 polyprenyl synthetase family protein -
  L6430_RS01695 degQ 314152..314292 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  L6430_RS01700 - 314904..315125 (+) 222 WP_230368259.1 hypothetical protein -
  L6430_RS01705 - 315168..316388 (-) 1221 WP_020452793.1 EAL and HDOD domain-containing protein -
  L6430_RS01710 - 316566..317975 (-) 1410 WP_229029889.1 nicotinate phosphoribosyltransferase -
  L6430_RS01715 - 318053..318604 (-) 552 WP_020452795.1 cysteine hydrolase family protein -
  L6430_RS01720 - 318790..319191 (-) 402 WP_025809741.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=91435 L6430_RS01695 WP_003184860.1 314152..314292(-) (degQ) [Bacillus paralicheniformis strain J41TS8]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=91435 L6430_RS01695 WP_003184860.1 314152..314292(-) (degQ) [Bacillus paralicheniformis strain J41TS8]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment