Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | L6430_RS01695 | Genome accession | NZ_AP025342 |
| Coordinates | 314152..314292 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | P69890 |
| Organism | Bacillus paralicheniformis strain J41TS8 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 309152..319292
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L6430_RS01670 | - | 309445..309834 (-) | 390 | WP_009329508.1 | hotdog fold thioesterase | - |
| L6430_RS01675 | comA | 309851..310489 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| L6430_RS01680 | comP | 310576..312891 (-) | 2316 | WP_020452789.1 | sensor histidine kinase | Regulator |
| L6430_RS01685 | comX | 312912..313082 (-) | 171 | WP_020452790.1 | competence pheromone ComX | - |
| L6430_RS01690 | - | 313054..313965 (-) | 912 | WP_020452791.1 | polyprenyl synthetase family protein | - |
| L6430_RS01695 | degQ | 314152..314292 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| L6430_RS01700 | - | 314904..315125 (+) | 222 | WP_230368259.1 | hypothetical protein | - |
| L6430_RS01705 | - | 315168..316388 (-) | 1221 | WP_020452793.1 | EAL and HDOD domain-containing protein | - |
| L6430_RS01710 | - | 316566..317975 (-) | 1410 | WP_229029889.1 | nicotinate phosphoribosyltransferase | - |
| L6430_RS01715 | - | 318053..318604 (-) | 552 | WP_020452795.1 | cysteine hydrolase family protein | - |
| L6430_RS01720 | - | 318790..319191 (-) | 402 | WP_025809741.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=91435 L6430_RS01695 WP_003184860.1 314152..314292(-) (degQ) [Bacillus paralicheniformis strain J41TS8]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=91435 L6430_RS01695 WP_003184860.1 314152..314292(-) (degQ) [Bacillus paralicheniformis strain J41TS8]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |