Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   L6450_RS08985 Genome accession   NZ_AP025340
Coordinates   1798848..1799024 (+) Length   58 a.a.
NCBI ID   WP_020452165.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain J36TS2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1793848..1804024
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L6450_RS08970 gcvT 1794488..1795582 (-) 1095 WP_020452162.1 glycine cleavage system aminomethyltransferase GcvT -
  L6450_RS08975 - 1796177..1797856 (+) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  L6450_RS08980 - 1797863..1798657 (+) 795 WP_020452164.1 YqhG family protein -
  L6450_RS08985 sinI 1798848..1799024 (+) 177 WP_020452165.1 anti-repressor SinI Regulator
  L6450_RS08990 sinR 1799058..1799393 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  L6450_RS08995 tasA 1799498..1800292 (-) 795 WP_020452167.1 biofilm matrix protein TasA -
  L6450_RS09000 sipW 1800365..1800949 (-) 585 WP_020452168.1 signal peptidase I SipW -
  L6450_RS09005 tapA 1800946..1801674 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  L6450_RS09010 - 1801952..1802272 (+) 321 WP_020452170.1 YqzG/YhdC family protein -
  L6450_RS09015 - 1802302..1802484 (-) 183 WP_020452171.1 YqzE family protein -
  L6450_RS09020 comGG 1802573..1802938 (-) 366 WP_020452172.1 competence type IV pilus minor pilin ComGG -
  L6450_RS09025 comGF 1802950..1803432 (-) 483 WP_228119627.1 competence type IV pilus minor pilin ComGF -
  L6450_RS09030 comGE 1803347..1803694 (-) 348 WP_020452174.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6694.49 Da        Isoelectric Point: 5.0637

>NTDB_id=91387 L6450_RS08985 WP_020452165.1 1798848..1799024(+) (sinI) [Bacillus paralicheniformis strain J36TS2]
MNKDKNEKEELDEEWTELIKHALEQGISPDDIRIFLNLGKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=91387 L6450_RS08985 WP_020452165.1 1798848..1799024(+) (sinI) [Bacillus paralicheniformis strain J36TS2]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGACGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5


Multiple sequence alignment