Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   L6432_RS07480 Genome accession   NZ_AP025339
Coordinates   1519418..1519594 (+) Length   58 a.a.
NCBI ID   WP_023855184.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain J25TS1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1514418..1524594
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L6432_RS07465 gcvT 1515058..1516152 (-) 1095 WP_035338369.1 glycine cleavage system aminomethyltransferase GcvT -
  L6432_RS07470 - 1516747..1518426 (+) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  L6432_RS07475 - 1518433..1519227 (+) 795 WP_020452164.1 YqhG family protein -
  L6432_RS07480 sinI 1519418..1519594 (+) 177 WP_023855184.1 anti-repressor SinI Regulator
  L6432_RS07485 sinR 1519628..1519963 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  L6432_RS07490 tasA 1520068..1520862 (-) 795 WP_020452167.1 biofilm matrix protein TasA -
  L6432_RS07495 sipW 1520935..1521519 (-) 585 WP_035338370.1 signal peptidase I SipW -
  L6432_RS07500 tapA 1521516..1522244 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  L6432_RS07505 - 1522522..1522842 (+) 321 WP_023855188.1 YqzG/YhdC family protein -
  L6432_RS07510 - 1522872..1523054 (-) 183 WP_020452171.1 YqzE family protein -
  L6432_RS07515 comGG 1523143..1523508 (-) 366 WP_025811163.1 competence type IV pilus minor pilin ComGG -
  L6432_RS07520 comGF 1523520..1524002 (-) 483 WP_230588654.1 competence type IV pilus minor pilin ComGF -
  L6432_RS07525 comGE 1523917..1524264 (-) 348 WP_025811161.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6709.46 Da        Isoelectric Point: 4.5938

>NTDB_id=91313 L6432_RS07480 WP_023855184.1 1519418..1519594(+) (sinI) [Bacillus paralicheniformis strain J25TS1]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGEKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=91313 L6432_RS07480 WP_023855184.1 1519418..1519594(+) (sinI) [Bacillus paralicheniformis strain J25TS1]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTGAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5


Multiple sequence alignment