Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HX0037_RS16965 Genome accession   NZ_CP139782
Coordinates   3420365..3420538 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain HX0037     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3415365..3425538
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HX0037_RS16915 comGD 3415486..3415923 (+) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  HX0037_RS16920 comGE 3415907..3416221 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  HX0037_RS16925 comGF 3416235..3416630 (+) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  HX0037_RS16930 comGG 3416631..3417008 (+) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  HX0037_RS16935 - 3417065..3417244 (+) 180 WP_003153093.1 YqzE family protein -
  HX0037_RS16940 - 3417284..3417613 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  HX0037_RS16945 tapA 3417872..3418543 (+) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  HX0037_RS16950 sipW 3418515..3419099 (+) 585 WP_012117977.1 signal peptidase I SipW -
  HX0037_RS16955 tasA 3419163..3419948 (+) 786 WP_094247735.1 biofilm matrix protein TasA -
  HX0037_RS16960 sinR 3419996..3420331 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HX0037_RS16965 sinI 3420365..3420538 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  HX0037_RS16970 - 3420715..3421509 (-) 795 WP_014305407.1 YqhG family protein -
  HX0037_RS16975 - 3421527..3423197 (-) 1671 WP_069013074.1 DEAD/DEAH box helicase -
  HX0037_RS16980 gcvT 3423621..3424721 (+) 1101 WP_094247736.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=911008 HX0037_RS16965 WP_003153105.1 3420365..3420538(-) (sinI) [Bacillus amyloliquefaciens strain HX0037]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=911008 HX0037_RS16965 WP_003153105.1 3420365..3420538(-) (sinI) [Bacillus amyloliquefaciens strain HX0037]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702