Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   HX0037_RS07310 Genome accession   NZ_CP139782
Coordinates   1559571..1559690 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain HX0037     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1554571..1564690
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HX0037_RS07285 - 1554810..1555568 (-) 759 WP_022552588.1 ABC transporter ATP-binding protein -
  HX0037_RS07290 - 1555562..1556509 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  HX0037_RS07295 ceuB 1556499..1557452 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  HX0037_RS07300 - 1557867..1559231 (+) 1365 WP_070081361.1 aspartate kinase -
  HX0037_RS07305 - 1559311..1559421 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  HX0037_RS07310 phrC 1559571..1559690 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  HX0037_RS07315 rapC 1559674..1560822 (-) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  HX0037_RS07320 - 1560975..1562408 (-) 1434 WP_161941456.1 sensor histidine kinase -
  HX0037_RS07325 - 1562395..1563078 (-) 684 WP_094247243.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=910963 HX0037_RS07310 WP_003156334.1 1559571..1559690(-) (phrC) [Bacillus amyloliquefaciens strain HX0037]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=910963 HX0037_RS07310 WP_003156334.1 1559571..1559690(-) (phrC) [Bacillus amyloliquefaciens strain HX0037]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718