Detailed information    

insolico Bioinformatically predicted

Overview


Name   vicX   Type   Regulator
Locus tag   SM123_RS03530 Genome accession   NZ_CP139419
Coordinates   767681..768490 (+) Length   269 a.a.
NCBI ID   WP_049475139.1    Uniprot ID   A0A6L6LBR7
Organism   Streptococcus lingualis strain S5     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 767681..812376 767681..768490 within 0


Gene organization within MGE regions


Location: 767681..812376
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SM123_RS03530 (SM123_03530) vicX 767681..768490 (+) 810 WP_049475139.1 MBL fold metallo-hydrolase Regulator
  SM123_RS03535 (SM123_03535) - 768917..769468 (+) 552 WP_320909833.1 hypothetical protein -
  SM123_RS03540 (SM123_03540) - 769502..769888 (+) 387 WP_320909834.1 YbaN family protein -
  SM123_RS03545 (SM123_03545) - 770005..771129 (-) 1125 WP_320909835.1 site-specific integrase -
  SM123_RS03550 (SM123_03550) - 771217..771522 (-) 306 WP_320909836.1 hypothetical protein -
  SM123_RS03555 (SM123_03555) - 771529..771906 (-) 378 WP_320909837.1 ImmA/IrrE family metallo-endopeptidase -
  SM123_RS03560 (SM123_03560) - 771903..772304 (-) 402 WP_320909838.1 helix-turn-helix domain-containing protein -
  SM123_RS03565 (SM123_03565) - 772468..772692 (+) 225 WP_320909839.1 DUF739 family protein -
  SM123_RS03570 (SM123_03570) - 772773..773018 (+) 246 WP_155169989.1 hypothetical protein -
  SM123_RS03575 (SM123_03575) - 773011..773268 (+) 258 WP_320909840.1 hypothetical protein -
  SM123_RS03580 (SM123_03580) - 773465..773782 (+) 318 WP_320909841.1 hypothetical protein -
  SM123_RS03585 (SM123_03585) - 773748..774434 (+) 687 WP_320909842.1 AAA family ATPase -
  SM123_RS03590 (SM123_03590) - 774554..774838 (+) 285 Protein_683 DEAD/DEAH box helicase family protein -
  SM123_RS03595 (SM123_03595) - 774980..775849 (+) 870 WP_320909995.1 helicase-related protein -
  SM123_RS03600 (SM123_03600) - 775856..776335 (+) 480 WP_320909843.1 DUF669 domain-containing protein -
  SM123_RS03605 (SM123_03605) - 776340..777122 (+) 783 WP_320909844.1 bifunctional DNA primase/polymerase -
  SM123_RS03610 (SM123_03610) - 777112..778659 (+) 1548 WP_320909845.1 phage/plasmid primase, P4 family -
  SM123_RS03615 (SM123_03615) - 778919..779242 (+) 324 WP_320909846.1 VRR-NUC domain-containing protein -
  SM123_RS03620 (SM123_03620) - 779235..780881 (+) 1647 WP_320909847.1 SIALI-17 repeat-containing surface protein -
  SM123_RS03625 (SM123_03625) - 780881..781240 (+) 360 WP_320909848.1 hypothetical protein -
  SM123_RS03630 (SM123_03630) - 781887..782396 (+) 510 WP_320909849.1 MazG-like family protein -
  SM123_RS03635 (SM123_03635) - 782389..783033 (+) 645 WP_320909850.1 DUF1642 domain-containing protein -
  SM123_RS03640 (SM123_03640) - 783030..783410 (+) 381 WP_320909851.1 hypothetical protein -
  SM123_RS03645 (SM123_03645) - 783552..783833 (+) 282 WP_320909852.1 hypothetical protein -
  SM123_RS03650 (SM123_03650) - 783938..784213 (+) 276 WP_320909853.1 hypothetical protein -
  SM123_RS03655 (SM123_03655) - 784215..784463 (+) 249 WP_320909854.1 hypothetical protein -
  SM123_RS03660 (SM123_03660) - 784447..784866 (+) 420 WP_320909855.1 DUF1492 domain-containing protein -
  SM123_RS03665 (SM123_03665) - 785014..785352 (+) 339 WP_320909856.1 HNH endonuclease -
  SM123_RS03670 (SM123_03670) - 785550..786017 (+) 468 WP_254729138.1 phage terminase small subunit P27 family -
  SM123_RS03680 (SM123_03680) - 786134..787861 (+) 1728 WP_320909996.1 terminase TerL endonuclease subunit -
  SM123_RS03685 (SM123_03685) - 788013..788165 (+) 153 WP_320909857.1 hypothetical protein -
  SM123_RS03690 (SM123_03690) - 788196..789425 (+) 1230 WP_320909858.1 phage portal protein -
  SM123_RS03695 (SM123_03695) - 789382..790062 (+) 681 WP_134974309.1 head maturation protease, ClpP-related -
  SM123_RS03700 (SM123_03700) - 790084..791253 (+) 1170 WP_320909859.1 phage major capsid protein -
  SM123_RS03705 (SM123_03705) - 791421..791756 (+) 336 WP_320909860.1 head-tail connector protein -
  SM123_RS03710 (SM123_03710) - 791713..792069 (+) 357 WP_320909861.1 head-tail adaptor protein -
  SM123_RS03715 (SM123_03715) - 792066..792443 (+) 378 WP_320909862.1 HK97-gp10 family putative phage morphogenesis protein -
  SM123_RS03720 (SM123_03720) - 792440..792889 (+) 450 WP_320909863.1 hypothetical protein -
  SM123_RS03725 (SM123_03725) - 792893..793444 (+) 552 WP_134974319.1 major tail protein -
  SM123_RS03730 (SM123_03730) - 793539..793877 (+) 339 WP_134974321.1 hypothetical protein -
  SM123_RS03735 (SM123_03735) - 793925..794068 (+) 144 WP_320909864.1 hypothetical protein -
  SM123_RS10270 - 794475..795119 (+) 645 Protein_712 phage tail tape measure protein -
  SM123_RS03745 (SM123_03745) - 795290..796234 (+) 945 WP_320909866.1 hypothetical protein -
  SM123_RS03750 (SM123_03750) - 796413..799691 (+) 3279 WP_320909867.1 phage tail tape measure protein -
  SM123_RS03755 (SM123_03755) - 799688..800404 (+) 717 WP_320909868.1 distal tail protein Dit -
  SM123_RS03760 (SM123_03760) - 800401..803499 (+) 3099 WP_320909869.1 phage tail spike protein -
  SM123_RS03765 (SM123_03765) - 803516..803752 (+) 237 WP_320909870.1 hypothetical protein -
  SM123_RS03770 (SM123_03770) - 803757..804377 (+) 621 WP_320909871.1 hypothetical protein -
  SM123_RS03775 (SM123_03775) - 804409..804858 (+) 450 WP_320909872.1 phage holin family protein -
  SM123_RS03780 (SM123_03780) - 804860..805189 (+) 330 WP_150905639.1 phage holin -
  SM123_RS03785 (SM123_03785) - 805200..806045 (+) 846 WP_320909873.1 lytic exoenzyme target recognition domain-containing protein -
  SM123_RS03790 (SM123_03790) - 806057..806476 (+) 420 WP_320909874.1 hypothetical protein -
  SM123_RS03795 (SM123_03795) - 806488..806838 (+) 351 WP_320909875.1 hypothetical protein -
  SM123_RS03800 (SM123_03800) - 806850..807734 (+) 885 WP_320909876.1 hypothetical protein -
  SM123_RS03805 (SM123_03805) rnc 808148..808849 (+) 702 WP_070506695.1 ribonuclease III -
  SM123_RS03810 (SM123_03810) smc 808840..812376 (+) 3537 WP_320909877.1 chromosome segregation protein SMC -

Sequence


Protein


Download         Length: 269 a.a.        Molecular weight: 29722.70 Da        Isoelectric Point: 5.9511

>NTDB_id=909530 SM123_RS03530 WP_049475139.1 767681..768490(+) (vicX) [Streptococcus lingualis strain S5]
MTEEGFKYSILASGSSGNSFYLETPKKKLLIDAGLSGKKITGLLAEIDRKPEDLDAILITHEHSDHIHGVGVLARKYGMD
LYANEATWKAMEGTKYLGKVDDAQKHIFEMGKTKTFGDIDIESFGVSHDAAAPQFYRLMKDGKSFVMLTDTGYVSDRLAG
IVADADGYLIESNHDVEILRAGSYAWRLKQRILSDLGHLSNEDGADAMIRTLGNRTKKIYLGHLSKENNIKELAHMTMEN
QLARADLAVGHDFEVLDTSPDTATPLTKI

Nucleotide


Download         Length: 810 bp        

>NTDB_id=909530 SM123_RS03530 WP_049475139.1 767681..768490(+) (vicX) [Streptococcus lingualis strain S5]
ATGACAGAAGAGGGATTTAAGTACAGTATTTTAGCTTCAGGTTCTAGTGGAAATTCTTTCTACCTTGAGACACCAAAGAA
AAAACTGCTTATTGATGCAGGGCTCTCAGGGAAAAAGATTACGGGACTATTGGCTGAAATTGATCGCAAACCAGAAGATT
TAGATGCCATTCTGATTACGCACGAACACTCAGACCATATCCATGGTGTGGGTGTTTTAGCGCGGAAATATGGGATGGAT
CTATATGCTAATGAAGCCACTTGGAAGGCTATGGAAGGTACCAAGTATCTAGGAAAGGTCGATGATGCTCAAAAGCATAT
CTTTGAAATGGGGAAGACCAAAACATTTGGCGATATCGATATCGAAAGTTTTGGGGTCAGTCACGATGCTGCAGCCCCTC
AATTCTATCGCTTGATGAAGGATGGGAAGAGCTTTGTCATGCTGACGGATACGGGCTATGTGAGTGATCGCTTAGCAGGA
ATCGTCGCGGATGCGGATGGCTATCTAATTGAGTCCAACCATGATGTAGAAATTCTTCGAGCAGGTTCGTATGCTTGGCG
TTTGAAGCAACGGATCTTGTCTGATCTGGGTCACCTTTCTAATGAAGATGGGGCAGATGCCATGATCCGGACCTTGGGAA
ATCGTACCAAGAAGATTTATCTGGGGCATTTGTCAAAAGAGAACAATATCAAAGAATTAGCCCATATGACCATGGAGAAC
CAACTGGCCAGAGCAGATCTAGCAGTCGGTCATGATTTTGAGGTGCTGGATACCTCACCAGACACCGCGACCCCTTTGAC
GAAGATATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6L6LBR7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  vicX Streptococcus mutans UA159

78.439

100

0.784