Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NC3_RS14690 Genome accession   NZ_AP025264
Coordinates   2845913..2846053 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain NC3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2840913..2851053
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NC3_RS14665 (NC3_28370) - 2841235..2841624 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  NC3_RS14670 (NC3_28380) comA 2841648..2842289 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  NC3_RS14675 (NC3_28390) comP 2842370..2844676 (-) 2307 WP_017358942.1 ATP-binding protein Regulator
  NC3_RS14680 (NC3_28400) comX 2844690..2844860 (-) 171 WP_017358941.1 competence pheromone ComX -
  NC3_RS14685 (NC3_28410) - 2844838..2845761 (-) 924 WP_017358940.1 polyprenyl synthetase family protein -
  NC3_RS14690 (NC3_28420) degQ 2845913..2846053 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NC3_RS14695 (NC3_28430) - 2846559..2846915 (+) 357 WP_050826564.1 hypothetical protein -
  NC3_RS14700 (NC3_28440) - 2846952..2848178 (-) 1227 WP_039963853.1 EAL and HDOD domain-containing protein -
  NC3_RS14705 (NC3_28450) - 2848319..2849788 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  NC3_RS14710 (NC3_28460) - 2849806..2850357 (-) 552 WP_008345872.1 cysteine hydrolase family protein -
  NC3_RS14715 (NC3_28470) - 2850418..2850825 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=90841 NC3_RS14690 WP_003213123.1 2845913..2846053(-) (degQ) [Bacillus altitudinis strain NC3]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=90841 NC3_RS14690 WP_003213123.1 2845913..2846053(-) (degQ) [Bacillus altitudinis strain NC3]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment