Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | SH594_RS13420 | Genome accession | NZ_CP139214 |
| Coordinates | 2648700..2648978 (+) | Length | 92 a.a. |
| NCBI ID | WP_063547383.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain A01 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2635754..2679821 | 2648700..2648978 | within | 0 |
Gene organization within MGE regions
Location: 2635754..2679821
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SH594_RS13310 (SH594_13310) | - | 2635754..2636017 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| SH594_RS13315 (SH594_13315) | - | 2636566..2636889 (+) | 324 | WP_063547374.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| SH594_RS13320 (SH594_13320) | - | 2637024..2637175 (+) | 152 | Protein_2546 | site-specific integrase | - |
| SH594_RS13325 (SH594_13325) | - | 2637385..2637870 (+) | 486 | WP_002041181.1 | hypothetical protein | - |
| SH594_RS13330 (SH594_13330) | - | 2638182..2638853 (+) | 672 | WP_000736204.1 | pPIWI_RE module domain-containing protein | - |
| SH594_RS13335 (SH594_13335) | - | 2638922..2640031 (-) | 1110 | WP_063547375.1 | tyrosine-type recombinase/integrase | - |
| SH594_RS13340 (SH594_13340) | - | 2640263..2640736 (+) | 474 | WP_063547376.1 | hypothetical protein | - |
| SH594_RS13345 (SH594_13345) | - | 2640970..2641431 (+) | 462 | WP_000734558.1 | hypothetical protein | - |
| SH594_RS13350 (SH594_13350) | - | 2641691..2642662 (+) | 972 | WP_063547377.1 | FRG domain-containing protein | - |
| SH594_RS13355 (SH594_13355) | - | 2643120..2644217 (+) | 1098 | WP_063547378.1 | AimR family lysis-lysogeny pheromone receptor | - |
| SH594_RS13360 (SH594_13360) | - | 2644230..2644379 (+) | 150 | WP_080469931.1 | hypothetical protein | - |
| SH594_RS13365 (SH594_13365) | - | 2644498..2644626 (+) | 129 | WP_255288311.1 | hypothetical protein | - |
| SH594_RS13370 (SH594_13370) | - | 2644642..2645010 (-) | 369 | WP_063547379.1 | helix-turn-helix domain-containing protein | - |
| SH594_RS13375 (SH594_13375) | - | 2645254..2645463 (+) | 210 | WP_063547380.1 | helix-turn-helix transcriptional regulator | - |
| SH594_RS13380 (SH594_13380) | - | 2645533..2645799 (+) | 267 | WP_000522020.1 | helix-turn-helix domain-containing protein | - |
| SH594_RS13385 (SH594_13385) | - | 2645799..2645963 (+) | 165 | WP_080469807.1 | hypothetical protein | - |
| SH594_RS13390 (SH594_13390) | - | 2645993..2646169 (+) | 177 | WP_080469808.1 | hypothetical protein | - |
| SH594_RS13395 (SH594_13395) | - | 2646174..2646917 (+) | 744 | WP_063547381.1 | DnaD domain protein | - |
| SH594_RS13400 (SH594_13400) | - | 2646886..2647689 (+) | 804 | WP_063547382.1 | ATP-binding protein | - |
| SH594_RS13405 (SH594_13405) | - | 2647704..2647898 (+) | 195 | WP_000332458.1 | hypothetical protein | - |
| SH594_RS13410 (SH594_13410) | - | 2647915..2648325 (+) | 411 | WP_000792379.1 | hypothetical protein | - |
| SH594_RS13415 (SH594_13415) | - | 2648358..2648612 (-) | 255 | WP_000312979.1 | hypothetical protein | - |
| SH594_RS13420 (SH594_13420) | abrB | 2648700..2648978 (+) | 279 | WP_063547383.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| SH594_RS13425 (SH594_13425) | - | 2648971..2649330 (+) | 360 | WP_063547384.1 | hypothetical protein | - |
| SH594_RS13430 (SH594_13430) | - | 2649349..2649516 (+) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| SH594_RS13435 (SH594_13435) | - | 2649542..2649793 (+) | 252 | WP_063547385.1 | hypothetical protein | - |
| SH594_RS13440 (SH594_13440) | - | 2649813..2650268 (+) | 456 | WP_063547386.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| SH594_RS13445 (SH594_13445) | - | 2650430..2650684 (+) | 255 | WP_050822240.1 | hypothetical protein | - |
| SH594_RS13450 (SH594_13450) | - | 2650795..2651394 (-) | 600 | WP_063547387.1 | undecaprenyl-diphosphatase | - |
| SH594_RS13455 (SH594_13455) | - | 2651934..2653316 (-) | 1383 | WP_063547388.1 | BclA C-terminal domain-containing protein | - |
| SH594_RS13460 (SH594_13460) | - | 2653600..2653920 (+) | 321 | WP_063547389.1 | hypothetical protein | - |
| SH594_RS13465 (SH594_13465) | - | 2653955..2654200 (+) | 246 | WP_063547390.1 | hypothetical protein | - |
| SH594_RS13470 (SH594_13470) | - | 2654323..2654598 (+) | 276 | WP_063547391.1 | hypothetical protein | - |
| SH594_RS13475 (SH594_13475) | - | 2654721..2655047 (+) | 327 | WP_063547392.1 | hypothetical protein | - |
| SH594_RS13480 (SH594_13480) | - | 2655096..2655194 (+) | 99 | WP_080469932.1 | DUF3983 domain-containing protein | - |
| SH594_RS13485 (SH594_13485) | - | 2655215..2655403 (+) | 189 | WP_063547393.1 | hypothetical protein | - |
| SH594_RS13490 (SH594_13490) | - | 2655502..2655672 (+) | 171 | WP_033695145.1 | hypothetical protein | - |
| SH594_RS13495 (SH594_13495) | - | 2655700..2656182 (+) | 483 | WP_063547394.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SH594_RS13500 (SH594_13500) | - | 2656182..2656724 (+) | 543 | WP_053564381.1 | site-specific integrase | - |
| SH594_RS13505 (SH594_13505) | - | 2656939..2657889 (+) | 951 | WP_061139243.1 | nucleoside hydrolase | - |
| SH594_RS13510 (SH594_13510) | - | 2658721..2658933 (+) | 213 | WP_063547395.1 | hypothetical protein | - |
| SH594_RS13515 (SH594_13515) | - | 2658930..2659151 (+) | 222 | WP_230387345.1 | hypothetical protein | - |
| SH594_RS13520 (SH594_13520) | - | 2659292..2659618 (+) | 327 | WP_063547396.1 | HNH endonuclease | - |
| SH594_RS13525 (SH594_13525) | - | 2659675..2659929 (+) | 255 | WP_404222201.1 | hypothetical protein | - |
| SH594_RS13530 (SH594_13530) | - | 2660239..2660736 (+) | 498 | WP_063547398.1 | P27 family phage terminase small subunit | - |
| SH594_RS13535 (SH594_13535) | - | 2660711..2662387 (+) | 1677 | WP_063547399.1 | terminase TerL endonuclease subunit | - |
| SH594_RS13540 (SH594_13540) | - | 2662404..2663648 (+) | 1245 | WP_063547400.1 | phage portal protein | - |
| SH594_RS13545 (SH594_13545) | - | 2663665..2664297 (+) | 633 | WP_003272656.1 | head maturation protease, ClpP-related | - |
| SH594_RS13550 (SH594_13550) | - | 2664311..2665435 (+) | 1125 | WP_000588590.1 | phage major capsid protein | - |
| SH594_RS13555 (SH594_13555) | - | 2665449..2665772 (+) | 324 | WP_001282872.1 | hypothetical protein | - |
| SH594_RS13560 (SH594_13560) | - | 2665762..2666118 (+) | 357 | WP_000963758.1 | hypothetical protein | - |
| SH594_RS13565 (SH594_13565) | - | 2666105..2666485 (+) | 381 | WP_016512759.1 | hypothetical protein | - |
| SH594_RS13570 (SH594_13570) | - | 2666475..2666885 (+) | 411 | WP_001111193.1 | hypothetical protein | - |
| SH594_RS13575 (SH594_13575) | - | 2666887..2667456 (+) | 570 | WP_001145608.1 | hypothetical protein | - |
| SH594_RS13580 (SH594_13580) | - | 2667518..2667868 (+) | 351 | WP_000159510.1 | hypothetical protein | - |
| SH594_RS13585 (SH594_13585) | - | 2668051..2671881 (+) | 3831 | WP_063547401.1 | phage tail tape measure protein | - |
| SH594_RS13590 (SH594_13590) | - | 2671874..2672560 (+) | 687 | WP_000227695.1 | hypothetical protein | - |
| SH594_RS13595 (SH594_13595) | - | 2672557..2675286 (+) | 2730 | WP_063547402.1 | phage tail spike protein | - |
| SH594_RS13600 (SH594_13600) | - | 2675325..2675561 (+) | 237 | WP_000387825.1 | hemolysin XhlA family protein | - |
| SH594_RS13605 (SH594_13605) | - | 2675561..2675800 (+) | 240 | WP_000461715.1 | hypothetical protein | - |
| SH594_RS13610 (SH594_13610) | - | 2675797..2676861 (+) | 1065 | WP_063547403.1 | N-acetylmuramoyl-L-alanine amidase | - |
| SH594_RS13615 (SH594_13615) | - | 2676903..2677829 (+) | 927 | WP_063547404.1 | exosporium leader peptide-containing protein | - |
| SH594_RS13620 (SH594_13620) | - | 2678094..2678393 (-) | 300 | WP_000998176.1 | contact-dependent growth inhibition system immunity protein | - |
| SH594_RS13625 (SH594_13625) | - | 2678412..2679821 (-) | 1410 | WP_063547405.1 | WXG100 family type VII secretion target | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10139.78 Da Isoelectric Point: 5.1546
>NTDB_id=908163 SH594_RS13420 WP_063547383.1 2648700..2648978(+) (abrB) [Bacillus cereus strain A01]
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAYA
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAYA
Nucleotide
Download Length: 279 bp
>NTDB_id=908163 SH594_RS13420 WP_063547383.1 2648700..2648978(+) (abrB) [Bacillus cereus strain A01]
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCATATGCCTAA
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCATATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
60.92 |
94.565 |
0.576 |