Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | SH594_RS12005 | Genome accession | NZ_CP139214 |
| Coordinates | 2339647..2339925 (+) | Length | 92 a.a. |
| NCBI ID | WP_063547228.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain A01 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2313480..2379134 | 2339647..2339925 | within | 0 |
Gene organization within MGE regions
Location: 2313480..2379134
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SH594_RS11835 (SH594_11835) | - | 2313480..2314028 (-) | 549 | WP_063547208.1 | hypothetical protein | - |
| SH594_RS11840 (SH594_11840) | - | 2314339..2314890 (+) | 552 | WP_053564527.1 | GNAT family N-acetyltransferase | - |
| SH594_RS11845 (SH594_11845) | - | 2314936..2315121 (-) | 186 | WP_000286203.1 | cold-shock protein | - |
| SH594_RS11850 (SH594_11850) | cspD | 2315208..2315411 (-) | 204 | WP_000176366.1 | cold-shock protein CspD | - |
| SH594_RS11855 (SH594_11855) | - | 2315794..2316690 (+) | 897 | WP_063547209.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SH594_RS11860 (SH594_11860) | - | 2316690..2317349 (+) | 660 | WP_142338410.1 | AAA family ATPase | - |
| SH594_RS11865 (SH594_11865) | - | 2317607..2318212 (+) | 606 | WP_063547211.1 | PRK06770 family protein | - |
| SH594_RS11870 (SH594_11870) | - | 2318283..2319149 (-) | 867 | WP_063547212.1 | LysR family transcriptional regulator | - |
| SH594_RS11875 (SH594_11875) | - | 2319279..2320322 (+) | 1044 | WP_063547213.1 | aspartate-semialdehyde dehydrogenase | - |
| SH594_RS11880 (SH594_11880) | - | 2320401..2320832 (-) | 432 | WP_063547214.1 | hypothetical protein | - |
| SH594_RS11885 (SH594_11885) | - | 2321119..2322243 (+) | 1125 | WP_063547215.1 | C45 family peptidase | - |
| SH594_RS11890 (SH594_11890) | - | 2322295..2322558 (+) | 264 | WP_063549298.1 | hypothetical protein | - |
| SH594_RS11895 (SH594_11895) | - | 2322655..2323557 (-) | 903 | WP_063547216.1 | LysR family transcriptional regulator | - |
| SH594_RS11900 (SH594_11900) | - | 2323714..2324403 (+) | 690 | WP_063547217.1 | MOSC domain-containing protein | - |
| SH594_RS11905 (SH594_11905) | - | 2324662..2325549 (+) | 888 | WP_063547218.1 | GNAT family N-acetyltransferase | - |
| SH594_RS11910 (SH594_11910) | - | 2325583..2326179 (+) | 597 | WP_063547219.1 | DUF1349 domain-containing protein | - |
| SH594_RS11915 (SH594_11915) | - | 2326401..2328155 (+) | 1755 | WP_063547220.1 | ABC transporter ATP-binding protein | - |
| SH594_RS11920 (SH594_11920) | - | 2328148..2329944 (+) | 1797 | WP_063547221.1 | ABC transporter ATP-binding protein | - |
| SH594_RS11925 (SH594_11925) | exsF | 2330579..2331082 (-) | 504 | WP_063547222.1 | exosporium protein ExsF | - |
| SH594_RS11930 (SH594_11930) | - | 2331468..2331752 (-) | 285 | WP_001123247.1 | DUF4183 domain-containing protein | - |
| SH594_RS11935 (SH594_11935) | - | 2332145..2333251 (-) | 1107 | WP_063547223.1 | site-specific integrase | - |
| SH594_RS11940 (SH594_11940) | - | 2333456..2333611 (+) | 156 | WP_196213901.1 | hypothetical protein | - |
| SH594_RS11945 (SH594_11945) | - | 2333738..2334091 (-) | 354 | WP_048558286.1 | helix-turn-helix domain-containing protein | - |
| SH594_RS11950 (SH594_11950) | - | 2334590..2335732 (+) | 1143 | WP_063547224.1 | AimR family lysis-lysogeny pheromone receptor | - |
| SH594_RS11955 (SH594_11955) | - | 2335765..2335917 (+) | 153 | WP_154400985.1 | hypothetical protein | - |
| SH594_RS11960 (SH594_11960) | - | 2336047..2336169 (+) | 123 | WP_255259040.1 | hypothetical protein | - |
| SH594_RS11965 (SH594_11965) | - | 2336183..2336527 (-) | 345 | WP_048558219.1 | helix-turn-helix domain-containing protein | - |
| SH594_RS11970 (SH594_11970) | - | 2336755..2336994 (+) | 240 | WP_063547225.1 | helix-turn-helix domain-containing protein | - |
| SH594_RS11975 (SH594_11975) | - | 2337076..2337342 (+) | 267 | WP_059303819.1 | helix-turn-helix domain-containing protein | - |
| SH594_RS11980 (SH594_11980) | - | 2337342..2337506 (+) | 165 | WP_033693158.1 | hypothetical protein | - |
| SH594_RS11985 (SH594_11985) | - | 2337536..2337712 (+) | 177 | WP_080469789.1 | hypothetical protein | - |
| SH594_RS11990 (SH594_11990) | - | 2337719..2338606 (+) | 888 | WP_063547226.1 | DnaD domain-containing protein | - |
| SH594_RS11995 (SH594_11995) | - | 2338545..2339420 (+) | 876 | WP_080469790.1 | ATP-binding protein | - |
| SH594_RS12000 (SH594_12000) | - | 2339436..2339630 (+) | 195 | WP_063547227.1 | hypothetical protein | - |
| SH594_RS12005 (SH594_12005) | abrB | 2339647..2339925 (+) | 279 | WP_063547228.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| SH594_RS12010 (SH594_12010) | - | 2339918..2340277 (+) | 360 | WP_063547229.1 | hypothetical protein | - |
| SH594_RS12015 (SH594_12015) | - | 2340297..2340464 (+) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| SH594_RS12020 (SH594_12020) | - | 2340490..2340741 (+) | 252 | WP_000109496.1 | hypothetical protein | - |
| SH594_RS12025 (SH594_12025) | - | 2340761..2341216 (+) | 456 | WP_063547230.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| SH594_RS12030 (SH594_12030) | - | 2341886..2342593 (-) | 708 | WP_063547231.1 | hypothetical protein | - |
| SH594_RS12035 (SH594_12035) | - | 2342645..2342818 (+) | 174 | WP_154816431.1 | hypothetical protein | - |
| SH594_RS12040 (SH594_12040) | - | 2342958..2343128 (+) | 171 | WP_080469791.1 | hypothetical protein | - |
| SH594_RS12045 (SH594_12045) | - | 2343156..2343638 (+) | 483 | WP_063547232.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SH594_RS12050 (SH594_12050) | - | 2343638..2344180 (+) | 543 | WP_063547233.1 | site-specific integrase | - |
| SH594_RS12055 (SH594_12055) | - | 2344335..2345843 (+) | 1509 | WP_063547234.1 | PIN domain-containing protein | - |
| SH594_RS12060 (SH594_12060) | - | 2346163..2346456 (+) | 294 | WP_063547235.1 | hypothetical protein | - |
| SH594_RS12065 (SH594_12065) | - | 2346584..2346868 (-) | 285 | WP_202626196.1 | hypothetical protein | - |
| SH594_RS12070 (SH594_12070) | - | 2346905..2347324 (-) | 420 | WP_063547237.1 | hypothetical protein | - |
| SH594_RS12075 (SH594_12075) | - | 2347491..2347853 (+) | 363 | WP_268865620.1 | HNH endonuclease | - |
| SH594_RS12080 (SH594_12080) | - | 2348002..2348460 (-) | 459 | WP_063547239.1 | hypothetical protein | - |
| SH594_RS12085 (SH594_12085) | - | 2348558..2349079 (+) | 522 | WP_063547240.1 | phage terminase small subunit P27 family | - |
| SH594_RS12090 (SH594_12090) | - | 2349088..2350803 (+) | 1716 | WP_063547241.1 | terminase large subunit | - |
| SH594_RS12095 (SH594_12095) | - | 2350817..2352058 (+) | 1242 | WP_063547242.1 | phage portal protein | - |
| SH594_RS12100 (SH594_12100) | - | 2352033..2352731 (+) | 699 | WP_002134054.1 | head maturation protease, ClpP-related | - |
| SH594_RS12105 (SH594_12105) | - | 2352769..2353941 (+) | 1173 | WP_063547243.1 | phage major capsid protein | - |
| SH594_RS12110 (SH594_12110) | - | 2353976..2354269 (+) | 294 | WP_063547244.1 | head-tail connector protein | - |
| SH594_RS12115 (SH594_12115) | - | 2354266..2354610 (+) | 345 | WP_001068032.1 | phage head closure protein | - |
| SH594_RS12120 (SH594_12120) | - | 2354598..2355035 (+) | 438 | WP_063547245.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SH594_RS12125 (SH594_12125) | - | 2355032..2355394 (+) | 363 | WP_063547246.1 | DUF3168 domain-containing protein | - |
| SH594_RS12130 (SH594_12130) | - | 2355410..2355994 (+) | 585 | WP_063547247.1 | major tail protein | - |
| SH594_RS12135 (SH594_12135) | gpG | 2356051..2356425 (+) | 375 | WP_015382157.1 | phage tail assembly chaperone G | - |
| SH594_RS12140 (SH594_12140) | - | 2356590..2361587 (+) | 4998 | WP_063547248.1 | phage tail tape measure protein | - |
| SH594_RS12145 (SH594_12145) | - | 2361627..2363084 (+) | 1458 | WP_063547249.1 | distal tail protein Dit | - |
| SH594_RS12150 (SH594_12150) | - | 2363081..2367439 (+) | 4359 | WP_063547250.1 | phage tail spike protein | - |
| SH594_RS12155 (SH594_12155) | - | 2367451..2367831 (+) | 381 | WP_063547251.1 | hypothetical protein | - |
| SH594_RS12160 (SH594_12160) | - | 2367927..2368163 (+) | 237 | Protein_2316 | hemolysin XhlA family protein | - |
| SH594_RS12165 (SH594_12165) | - | 2368163..2368402 (+) | 240 | WP_000461725.1 | hypothetical protein | - |
| SH594_RS12170 (SH594_12170) | - | 2368399..2369463 (+) | 1065 | WP_063547252.1 | N-acetylmuramoyl-L-alanine amidase | - |
| SH594_RS12175 (SH594_12175) | - | 2369686..2371770 (+) | 2085 | WP_063547253.1 | P-loop NTPase fold protein | - |
| SH594_RS12180 (SH594_12180) | - | 2371878..2372090 (-) | 213 | WP_063547254.1 | hypothetical protein | - |
| SH594_RS12185 (SH594_12185) | - | 2372383..2372619 (-) | 237 | WP_000774113.1 | hypothetical protein | - |
| SH594_RS12190 (SH594_12190) | - | 2373006..2373788 (-) | 783 | WP_053564517.1 | glycosyltransferase family 2 protein | - |
| SH594_RS12195 (SH594_12195) | - | 2373968..2374552 (-) | 585 | WP_001121273.1 | LysE family transporter | - |
| SH594_RS12200 (SH594_12200) | - | 2374608..2375222 (+) | 615 | WP_130813712.1 | helix-turn-helix domain-containing protein | - |
| SH594_RS12205 (SH594_12205) | - | 2375589..2376212 (-) | 624 | WP_063547255.1 | BclA C-terminal domain-containing protein | - |
| SH594_RS12210 (SH594_12210) | - | 2376429..2377259 (+) | 831 | WP_063553415.1 | DUF4183 domain-containing protein | - |
| SH594_RS12215 (SH594_12215) | - | 2377821..2379134 (+) | 1314 | WP_063547257.1 | exosporium glycoprotein BclB-related protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 9941.41 Da Isoelectric Point: 5.1665
>NTDB_id=908161 SH594_RS12005 WP_063547228.1 2339647..2339925(+) (abrB) [Bacillus cereus strain A01]
MKNTGVARKVDELGRVVIPIELRRTLGIAEGTALGFHVEGENIVLRKQDKSCFVTGEVSESNIELLDGRMFLSKEGASEL
LGVIEKSGNVNA
MKNTGVARKVDELGRVVIPIELRRTLGIAEGTALGFHVEGENIVLRKQDKSCFVTGEVSESNIELLDGRMFLSKEGASEL
LGVIEKSGNVNA
Nucleotide
Download Length: 279 bp
>NTDB_id=908161 SH594_RS12005 WP_063547228.1 2339647..2339925(+) (abrB) [Bacillus cereus strain A01]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAATAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGAGAAAACATCGTTTTAAGAAAACAGGATAAGTCGTGCTTTG
TAACGGGTGAAGTTTCTGAATCAAACATAGAGTTGCTAGATGGTCGGATGTTTTTAAGCAAGGAAGGTGCAAGTGAGTTG
CTAGGCGTTATTGAGAAGAGTGGGAATGTAAATGCCTAA
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAATAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGAGAAAACATCGTTTTAAGAAAACAGGATAAGTCGTGCTTTG
TAACGGGTGAAGTTTCTGAATCAAACATAGAGTTGCTAGATGGTCGGATGTTTTTAAGCAAGGAAGGTGCAAGTGAGTTG
CTAGGCGTTATTGAGAAGAGTGGGAATGTAAATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
58.621 |
94.565 |
0.554 |