Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   SK061_RS20990 Genome accession   NZ_CP139190
Coordinates   4023201..4023485 (-) Length   94 a.a.
NCBI ID   WP_006639122.1    Uniprot ID   -
Organism   Bacillus sonorensis strain PMC204     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3974730..4028339 4023201..4023485 within 0


Gene organization within MGE regions


Location: 3974730..4028339
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SK061_RS20670 (SK061_20670) - 3974730..3975098 (+) 369 WP_182423284.1 YolD-like family protein -
  SK061_RS20675 (SK061_20675) - 3975149..3975631 (-) 483 WP_017474569.1 hypothetical protein -
  SK061_RS20680 (SK061_20680) - 3975624..3976262 (-) 639 WP_017474568.1 hypothetical protein -
  SK061_RS20685 (SK061_20685) - 3976613..3978334 (+) 1722 WP_244185758.1 T7SS effector LXG polymorphic toxin -
  SK061_RS20690 (SK061_20690) - 3978353..3978697 (+) 345 WP_035338314.1 hypothetical protein -
  SK061_RS20695 (SK061_20695) - 3978827..3979333 (-) 507 WP_020450731.1 hypothetical protein -
  SK061_RS20700 (SK061_20700) - 3979458..3979688 (+) 231 WP_020450730.1 hypothetical protein -
  SK061_RS20705 (SK061_20705) - 3979816..3980769 (-) 954 WP_069500668.1 glycoside hydrolase family 25 protein -
  SK061_RS20710 (SK061_20710) - 3980817..3981080 (-) 264 WP_069500669.1 phage holin -
  SK061_RS20715 (SK061_20715) - 3981096..3981365 (-) 270 WP_069500916.1 hemolysin XhlA family protein -
  SK061_RS20720 (SK061_20720) - 3981428..3981613 (-) 186 WP_069500670.1 XkdX family protein -
  SK061_RS20725 (SK061_20725) - 3981610..3981933 (-) 324 WP_088273051.1 hypothetical protein -
  SK061_RS20730 (SK061_20730) - 3981946..3983295 (-) 1350 WP_061578557.1 phage baseplate upper protein -
  SK061_RS20735 (SK061_20735) - 3983309..3985954 (-) 2646 WP_088273053.1 peptidase G2 autoproteolytic cleavage domain-containing protein -
  SK061_RS20740 (SK061_20740) - 3985991..3987703 (-) 1713 WP_088273054.1 phage tail protein -
  SK061_RS20745 (SK061_20745) - 3987716..3988552 (-) 837 WP_088273056.1 phage tail family protein -
  SK061_RS20750 (SK061_20750) - 3988552..3993024 (-) 4473 WP_088273058.1 phage tail tape measure protein -
  SK061_RS20755 (SK061_20755) gpG 3993233..3993595 (-) 363 WP_003185339.1 phage tail assembly chaperone G -
  SK061_RS20760 (SK061_20760) - 3993649..3994266 (-) 618 WP_003185341.1 major tail protein -
  SK061_RS20765 (SK061_20765) - 3994281..3994664 (-) 384 WP_006637250.1 phage protein -
  SK061_RS20770 (SK061_20770) - 3994661..3995059 (-) 399 WP_006637249.1 HK97-gp10 family putative phage morphogenesis protein -
  SK061_RS20775 (SK061_20775) - 3995059..3995367 (-) 309 WP_006637248.1 phage head closure protein -
  SK061_RS20780 (SK061_20780) - 3995357..3995659 (-) 303 WP_006637247.1 head-tail connector protein -
  SK061_RS20785 (SK061_20785) - 3995680..3996108 (-) 429 WP_006637246.1 collagen-like protein -
  SK061_RS20790 (SK061_20790) - 3996132..3997415 (-) 1284 WP_006637245.1 phage major capsid protein -
  SK061_RS20795 (SK061_20795) - 3997454..3998185 (-) 732 WP_006637244.1 head maturation protease, ClpP-related -
  SK061_RS20800 (SK061_20800) - 3998130..3999440 (-) 1311 WP_006637243.1 phage portal protein -
  SK061_RS20805 (SK061_20805) - 3999441..3999632 (-) 192 WP_006637242.1 DUF1056 family protein -
  SK061_RS20810 (SK061_20810) - 3999644..4001353 (-) 1710 WP_061578330.1 terminase large subunit -
  SK061_RS20815 (SK061_20815) - 4001350..4001864 (-) 515 Protein_4067 phage terminase small subunit P27 family -
  SK061_RS20820 (SK061_20820) - 4002096..4002470 (-) 375 WP_088272692.1 HNH endonuclease -
  SK061_RS20825 (SK061_20825) - 4002948..4003595 (-) 648 WP_048407182.1 hypothetical protein -
  SK061_RS20830 (SK061_20830) - 4004020..4004400 (-) 381 WP_088272691.1 ArpU family phage packaging/lysis transcriptional regulator -
  SK061_RS20835 (SK061_20835) - 4004513..4004890 (-) 378 WP_088272690.1 YopX family protein -
  SK061_RS20840 (SK061_20840) - 4004906..4005427 (-) 522 WP_244185783.1 putative metallopeptidase -
  SK061_RS20845 (SK061_20845) - 4005424..4005594 (-) 171 WP_071583658.1 Fur-regulated basic protein FbpA -
  SK061_RS20850 (SK061_20850) - 4005591..4006130 (-) 540 WP_025807627.1 ERCC4 domain-containing protein -
  SK061_RS20855 (SK061_20855) - 4006127..4006564 (-) 438 WP_025807629.1 hypothetical protein -
  SK061_RS20860 (SK061_20860) - 4006542..4006805 (-) 264 WP_025807631.1 hypothetical protein -
  SK061_RS20865 (SK061_20865) - 4007082..4009514 (-) 2433 WP_069500785.1 phage/plasmid primase, P4 family -
  SK061_RS20870 (SK061_20870) - 4009575..4010012 (-) 438 WP_061576092.1 DUF669 domain-containing protein -
  SK061_RS20875 (SK061_20875) - 4010012..4010944 (-) 933 WP_061565941.1 AAA family ATPase -
  SK061_RS20880 (SK061_20880) - 4010948..4011505 (-) 558 WP_088272689.1 host-nuclease inhibitor Gam family protein -
  SK061_RS20885 (SK061_20885) - 4011605..4011847 (-) 243 WP_011198322.1 hypothetical protein -
  SK061_RS20890 (SK061_20890) - 4011935..4012201 (-) 267 WP_009330095.1 YqaH family protein -
  SK061_RS20895 (SK061_20895) - 4012256..4012570 (+) 315 WP_048406869.1 hypothetical protein -
  SK061_RS20900 (SK061_20900) - 4012642..4012887 (-) 246 WP_048407027.1 hypothetical protein -
  SK061_RS20905 (SK061_20905) - 4012934..4013089 (-) 156 WP_155759051.1 hypothetical protein -
  SK061_RS20910 (SK061_20910) - 4013145..4013435 (+) 291 WP_017474699.1 hypothetical protein -
  SK061_RS20915 (SK061_20915) - 4013422..4013586 (-) 165 WP_017474700.1 hypothetical protein -
  SK061_RS20920 (SK061_20920) - 4013738..4014292 (-) 555 WP_088272688.1 hypothetical protein -
  SK061_RS20925 (SK061_20925) - 4014350..4014538 (-) 189 WP_016886536.1 hypothetical protein -
  SK061_RS20930 (SK061_20930) - 4014670..4014858 (-) 189 WP_003185403.1 helix-turn-helix transcriptional regulator -
  SK061_RS20935 (SK061_20935) - 4014855..4015649 (-) 795 WP_003185404.1 ORF6N domain-containing protein -
  SK061_RS20940 (SK061_20940) - 4015711..4016028 (+) 318 WP_016886534.1 hypothetical protein -
  SK061_RS20945 (SK061_20945) - 4015991..4016260 (-) 270 WP_016886533.1 hypothetical protein -
  SK061_RS20950 (SK061_20950) - 4016275..4016514 (-) 240 WP_044789338.1 helix-turn-helix domain-containing protein -
  SK061_RS20955 (SK061_20955) - 4016671..4017321 (+) 651 WP_016886531.1 LexA family transcriptional regulator -
  SK061_RS20960 (SK061_20960) - 4017392..4018486 (+) 1095 WP_003185410.1 site-specific integrase -
  SK061_RS20970 (SK061_20970) smpB 4019040..4019513 (-) 474 WP_006639118.1 SsrA-binding protein -
  SK061_RS20975 (SK061_20975) rnr 4019626..4021920 (-) 2295 WP_088272687.1 ribonuclease R -
  SK061_RS20980 (SK061_20980) - 4021934..4022680 (-) 747 WP_006639120.1 carboxylesterase -
  SK061_RS20985 (SK061_20985) secG 4022811..4023041 (-) 231 WP_006639121.1 preprotein translocase subunit SecG -
  SK061_RS20990 (SK061_20990) abrB 4023201..4023485 (-) 285 WP_006639122.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  SK061_RS20995 (SK061_20995) - 4023515..4023745 (-) 231 WP_006639123.1 helix-turn-helix transcriptional regulator -
  SK061_RS21000 (SK061_21000) - 4023901..4024305 (+) 405 WP_006639124.1 helix-turn-helix domain-containing protein -
  SK061_RS21005 (SK061_21005) - 4024458..4024856 (+) 399 WP_029419541.1 helix-turn-helix domain-containing protein -
  SK061_RS21010 (SK061_21010) - 4024900..4025577 (-) 678 WP_006639126.1 ABC transporter permease -
  SK061_RS21015 (SK061_21015) opuCC 4025596..4026513 (-) 918 WP_006639127.1 osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC -
  SK061_RS21020 (SK061_21020) - 4026527..4027180 (-) 654 WP_006639128.1 ABC transporter permease -
  SK061_RS21025 (SK061_21025) - 4027197..4028339 (-) 1143 WP_006639129.1 betaine/proline/choline family ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10487.30 Da        Isoelectric Point: 7.9636

>NTDB_id=907755 SK061_RS20990 WP_006639122.1 4023201..4023485(-) (abrB) [Bacillus sonorensis strain PMC204]
MKNTGIVRRIDELGRVVLPVELRRVLNIKEKDPLEIYSDGDNIILAKYAANMACLMTGEITTQNKTYAGGKIILSPRGAE
MLLEDLLEALSNRK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=907755 SK061_RS20990 WP_006639122.1 4023201..4023485(-) (abrB) [Bacillus sonorensis strain PMC204]
ATGAAGAATACCGGAATTGTAAGAAGAATCGATGAGCTTGGCCGGGTGGTCCTGCCGGTGGAACTGAGAAGGGTGCTGAA
TATCAAGGAAAAAGATCCGCTTGAAATTTACAGCGACGGCGACAATATCATTCTTGCCAAATATGCAGCAAACATGGCCT
GTCTGATGACCGGTGAAATCACGACACAGAACAAAACGTACGCAGGCGGCAAAATCATCCTCAGCCCGCGCGGCGCCGAA
ATGCTTTTGGAAGATTTGCTGGAGGCCTTGTCCAACAGGAAATAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(53-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(9-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.383

100

0.564