Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ABLU28_RS03635 Genome accession   NZ_CP157495
Coordinates   714918..715202 (+) Length   94 a.a.
NCBI ID   WP_010906314.1    Uniprot ID   Q9CDU4
Organism   Lactococcus lactis strain 2B-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 709918..720202
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABLU28_RS03605 (ABLU28_03605) comGA 711509..712447 (+) 939 WP_058212859.1 competence type IV pilus ATPase ComGA Machinery gene
  ABLU28_RS03610 (ABLU28_03610) comGB 712395..713414 (+) 1020 Protein_666 competence type IV pilus assembly protein ComGB -
  ABLU28_RS03615 (ABLU28_03615) comGC 713428..713811 (+) 384 WP_010906318.1 competence type IV pilus major pilin ComGC Machinery gene
  ABLU28_RS03620 (ABLU28_03620) comGD 713786..714202 (+) 417 WP_021216554.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABLU28_RS03625 (ABLU28_03625) comGE 714174..714470 (+) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABLU28_RS03630 (ABLU28_03630) comGF 714433..714879 (+) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  ABLU28_RS03635 (ABLU28_03635) comGG 714918..715202 (+) 285 WP_010906314.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABLU28_RS03640 (ABLU28_03640) - 715283..715720 (+) 438 WP_058213216.1 zinc-dependent MarR family transcriptional regulator -
  ABLU28_RS03645 (ABLU28_03645) - 715717..716559 (+) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  ABLU28_RS03650 (ABLU28_03650) - 716736..717473 (+) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  ABLU28_RS03655 (ABLU28_03655) - 717466..718275 (+) 810 WP_014570791.1 metal ABC transporter permease -
  ABLU28_RS03660 (ABLU28_03660) - 718314..719180 (-) 867 WP_058213299.1 RluA family pseudouridine synthase -
  ABLU28_RS03665 (ABLU28_03665) - 719385..719762 (+) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=905873 ABLU28_RS03635 WP_010906314.1 714918..715202(+) (comGG) [Lactococcus lactis strain 2B-1]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=905873 ABLU28_RS03635 WP_010906314.1 714918..715202(+) (comGG) [Lactococcus lactis strain 2B-1]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9CDU4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

59.14

98.936

0.585