Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BSG8_RS15595 Genome accession   NZ_AP025224
Coordinates   2893918..2894058 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. natto strain G8     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2888918..2899058
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSG8_RS15570 (BSG8_30800) yuxO 2889195..2889575 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  BSG8_RS15575 (BSG8_30810) comA 2889594..2890238 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSG8_RS15580 (BSG8_30820) comP 2890319..2892631 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  BSG8_RS15585 (BSG8_30830) comX 2892647..2892868 (-) 222 WP_014480704.1 competence pheromone ComX -
  BSG8_RS15590 (BSG8_30840) - 2892870..2893733 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  BSG8_RS15595 (BSG8_30850) degQ 2893918..2894058 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSG8_RS15600 - 2894280..2894405 (+) 126 WP_003228793.1 hypothetical protein -
  BSG8_RS15605 (BSG8_30860) - 2894519..2894887 (+) 369 WP_014477834.1 hypothetical protein -
  BSG8_RS15610 (BSG8_30870) pdeH 2894863..2896092 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  BSG8_RS15615 (BSG8_30880) pncB 2896228..2897700 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  BSG8_RS15620 (BSG8_30890) pncA 2897716..2898267 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  BSG8_RS15625 (BSG8_30900) yueI 2898364..2898762 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=90585 BSG8_RS15595 WP_003220708.1 2893918..2894058(-) (degQ) [Bacillus subtilis subsp. natto strain G8]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=90585 BSG8_RS15595 WP_003220708.1 2893918..2894058(-) (degQ) [Bacillus subtilis subsp. natto strain G8]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment