Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   BSG8_RS05840 Genome accession   NZ_AP025224
Coordinates   1115893..1116084 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. natto strain G8     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1110893..1121084
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSG8_RS05810 (BSG8_11360) argF 1111560..1112519 (+) 960 WP_014479432.1 ornithine carbamoyltransferase -
  BSG8_RS05815 (BSG8_11370) yjzC 1112802..1112981 (+) 180 WP_003245356.1 YjzC family protein -
  BSG8_RS05820 (BSG8_11380) yjzD 1113027..1113212 (-) 186 WP_003245236.1 DUF2929 domain-containing protein -
  BSG8_RS05825 (BSG8_11390) - 1113461..1114195 (+) 735 WP_014479433.1 hypothetical protein -
  BSG8_RS05830 (BSG8_11400) - 1114277..1114834 (+) 558 WP_014479435.1 hypothetical protein -
  BSG8_RS05835 (BSG8_11410) med 1114925..1115878 (+) 954 WP_014479436.1 transcriptional regulator Med Regulator
  BSG8_RS05840 (BSG8_11420) comZ 1115893..1116084 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  BSG8_RS05845 (BSG8_11430) yjzB 1116114..1116341 (-) 228 WP_031600361.1 spore coat protein YjzB -
  BSG8_RS05850 (BSG8_11440) fabH 1116506..1117444 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  BSG8_RS05855 (BSG8_11450) fabF 1117467..1118708 (+) 1242 WP_014479438.1 beta-ketoacyl-ACP synthase II -
  BSG8_RS05860 (BSG8_11460) yjaZ 1118784..1119569 (+) 786 WP_014479439.1 DUF2268 domain-containing protein -
  BSG8_RS05865 (BSG8_11470) appD 1119761..1120747 (+) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=90543 BSG8_RS05840 WP_003224559.1 1115893..1116084(+) (comZ) [Bacillus subtilis subsp. natto strain G8]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=90543 BSG8_RS05840 WP_003224559.1 1115893..1116084(+) (comZ) [Bacillus subtilis subsp. natto strain G8]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterproScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment