Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   SBP12_RS15165 Genome accession   NZ_CP138634
Coordinates   3050812..3050952 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain A5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3045812..3055952
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SBP12_RS15135 (SBP12_15135) - 3045974..3046357 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  SBP12_RS15140 (SBP12_15140) comA 3046379..3047023 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  SBP12_RS15145 (SBP12_15145) - 3047104..3049011 (-) 1908 Protein_2919 histidine kinase -
  SBP12_RS15150 (SBP12_15150) - 3049016..3049573 (-) 558 Protein_2920 PDZ domain-containing protein -
  SBP12_RS15155 (SBP12_15155) comX 3049585..3049749 (-) 165 WP_007613432.1 competence pheromone ComX -
  SBP12_RS15160 (SBP12_15160) - 3049749..3050660 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  SBP12_RS15165 (SBP12_15165) degQ 3050812..3050952 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  SBP12_RS15170 (SBP12_15170) - 3051418..3051759 (+) 342 WP_014305721.1 hypothetical protein -
  SBP12_RS15175 (SBP12_15175) - 3051766..3052986 (-) 1221 WP_039254052.1 EAL and HDOD domain-containing protein -
  SBP12_RS15180 (SBP12_15180) - 3053116..3054582 (-) 1467 WP_099686880.1 nicotinate phosphoribosyltransferase -
  SBP12_RS15185 (SBP12_15185) - 3054600..3055151 (-) 552 WP_025853916.1 cysteine hydrolase family protein -
  SBP12_RS15190 (SBP12_15190) - 3055248..3055646 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=903872 SBP12_RS15165 WP_003152043.1 3050812..3050952(-) (degQ) [Bacillus velezensis strain A5]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=903872 SBP12_RS15165 WP_003152043.1 3050812..3050952(-) (degQ) [Bacillus velezensis strain A5]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891