Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   SBP12_RS12185 Genome accession   NZ_CP138634
Coordinates   2493141..2493518 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain A5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2488141..2498518
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SBP12_RS12145 (SBP12_12145) - 2488639..2489433 (+) 795 WP_007408330.1 YqhG family protein -
  SBP12_RS12150 (SBP12_12150) sinI 2489610..2489783 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  SBP12_RS12155 (SBP12_12155) sinR 2489817..2490152 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SBP12_RS12160 (SBP12_12160) tasA 2490200..2490985 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  SBP12_RS12165 (SBP12_12165) sipW 2491050..2491634 (-) 585 WP_015240205.1 signal peptidase I SipW -
  SBP12_RS12170 (SBP12_12170) tapA 2491606..2492277 (-) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  SBP12_RS12175 (SBP12_12175) - 2492536..2492865 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  SBP12_RS12180 (SBP12_12180) - 2492905..2493084 (-) 180 WP_003153093.1 YqzE family protein -
  SBP12_RS12185 (SBP12_12185) comGG 2493141..2493518 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  SBP12_RS12190 (SBP12_12190) comGF 2493519..2494019 (-) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  SBP12_RS12195 (SBP12_12195) comGE 2493928..2494242 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  SBP12_RS12200 (SBP12_12200) comGD 2494226..2494663 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  SBP12_RS12205 (SBP12_12205) comGC 2494653..2494961 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  SBP12_RS12210 (SBP12_12210) comGB 2494966..2496003 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  SBP12_RS12215 (SBP12_12215) comGA 2495990..2497060 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  SBP12_RS12220 (SBP12_12220) - 2497253..2498203 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=903854 SBP12_RS12185 WP_015417814.1 2493141..2493518(-) (comGG) [Bacillus velezensis strain A5]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=903854 SBP12_RS12185 WP_015417814.1 2493141..2493518(-) (comGG) [Bacillus velezensis strain A5]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACTTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504