Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ABI226_RS17250 Genome accession   NZ_CP157216
Coordinates   3261327..3261467 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS22     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3256327..3266467
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABI226_RS17225 (ABI226_17225) yuxO 3256640..3257020 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ABI226_RS17230 (ABI226_17230) comA 3257039..3257683 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ABI226_RS17235 (ABI226_17235) comP 3257764..3260073 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  ABI226_RS17240 (ABI226_17240) comX 3260088..3260255 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ABI226_RS17245 (ABI226_17245) comQ 3260243..3261142 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ABI226_RS17250 (ABI226_17250) degQ 3261327..3261467 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ABI226_RS17255 (ABI226_17255) - 3261689..3261814 (+) 126 WP_003228793.1 hypothetical protein -
  ABI226_RS17260 (ABI226_17260) - 3261928..3262296 (+) 369 WP_003243784.1 hypothetical protein -
  ABI226_RS17265 (ABI226_17265) pdeH 3262272..3263501 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ABI226_RS17270 (ABI226_17270) pncB 3263638..3265110 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ABI226_RS17275 (ABI226_17275) pncA 3265126..3265677 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  ABI226_RS17280 (ABI226_17280) yueI 3265774..3266172 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=903229 ABI226_RS17250 WP_003220708.1 3261327..3261467(-) (degQ) [Bacillus subtilis subsp. subtilis isolate FELIX_MS22]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=903229 ABI226_RS17250 WP_003220708.1 3261327..3261467(-) (degQ) [Bacillus subtilis subsp. subtilis isolate FELIX_MS22]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1