Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   SBO70_RS16585 Genome accession   NZ_CP137890
Coordinates   3323673..3323813 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain GJJK74     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3318673..3328813
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SBO70_RS16555 (SBO70_16555) mnhG 3318686..3319060 (+) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  SBO70_RS16560 (SBO70_16560) - 3319100..3319483 (-) 384 WP_040238946.1 hotdog fold thioesterase -
  SBO70_RS16565 (SBO70_16565) - 3319505..3320019 (-) 515 Protein_3207 response regulator transcription factor -
  SBO70_RS16570 (SBO70_16570) comP 3320100..3322403 (-) 2304 WP_040238945.1 histidine kinase Regulator
  SBO70_RS16580 (SBO70_16580) comQ 3322556..3323542 (-) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  SBO70_RS16585 (SBO70_16585) degQ 3323673..3323813 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  SBO70_RS16590 (SBO70_16590) - 3324276..3324617 (+) 342 WP_015418107.1 hypothetical protein -
  SBO70_RS16595 (SBO70_16595) - 3324624..3325847 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  SBO70_RS16600 (SBO70_16600) - 3325977..3327443 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  SBO70_RS16605 (SBO70_16605) - 3327461..3328012 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  SBO70_RS16610 (SBO70_16610) - 3328109..3328507 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=901203 SBO70_RS16585 WP_003152043.1 3323673..3323813(-) (degQ) [Bacillus velezensis strain GJJK74]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=901203 SBO70_RS16585 WP_003152043.1 3323673..3323813(-) (degQ) [Bacillus velezensis strain GJJK74]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891