Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | R6Y98_RS12540 | Genome accession | NZ_CP137767 |
| Coordinates | 2441945..2442223 (+) | Length | 92 a.a. |
| NCBI ID | WP_318588524.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain GUCC 3 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2430744..2473967 | 2441945..2442223 | within | 0 |
Gene organization within MGE regions
Location: 2430744..2473967
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R6Y98_RS12450 (R6Y98_12450) | - | 2430744..2431007 (+) | 264 | WP_070183883.1 | DUF3937 family protein | - |
| R6Y98_RS12455 (R6Y98_12455) | - | 2431564..2431881 (+) | 318 | WP_002006106.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| R6Y98_RS12460 (R6Y98_12460) | - | 2432283..2432744 (+) | 462 | WP_000358744.1 | nucleoside 2-deoxyribosyltransferase | - |
| R6Y98_RS12465 (R6Y98_12465) | - | 2432758..2432940 (-) | 183 | Protein_2375 | restriction endonuclease | - |
| R6Y98_RS12470 (R6Y98_12470) | - | 2433096..2433391 (+) | 296 | Protein_2376 | hypothetical protein | - |
| R6Y98_RS12475 (R6Y98_12475) | - | 2433388..2433570 (+) | 183 | Protein_2377 | hypothetical protein | - |
| R6Y98_RS12480 (R6Y98_12480) | - | 2433689..2433820 (+) | 132 | WP_000891530.1 | hypothetical protein | - |
| R6Y98_RS12485 (R6Y98_12485) | - | 2434066..2434737 (+) | 672 | WP_098537256.1 | pPIWI_RE module domain-containing protein | - |
| R6Y98_RS12490 (R6Y98_12490) | - | 2434806..2435915 (-) | 1110 | WP_016124616.1 | tyrosine-type recombinase/integrase | - |
| R6Y98_RS12495 (R6Y98_12495) | - | 2436219..2437376 (+) | 1158 | WP_318588523.1 | exosporium leader peptide-containing protein | - |
| R6Y98_RS12500 (R6Y98_12500) | - | 2437941..2439092 (+) | 1152 | WP_086402205.1 | AimR family lysis-lysogeny pheromone receptor | - |
| R6Y98_RS12505 (R6Y98_12505) | - | 2439130..2439276 (+) | 147 | WP_000720927.1 | hypothetical protein | - |
| R6Y98_RS12510 (R6Y98_12510) | - | 2439432..2439560 (+) | 129 | WP_000836786.1 | hypothetical protein | - |
| R6Y98_RS12515 (R6Y98_12515) | - | 2439596..2439949 (-) | 354 | WP_000491272.1 | helix-turn-helix domain-containing protein | - |
| R6Y98_RS12520 (R6Y98_12520) | - | 2440150..2440341 (+) | 192 | WP_000854271.1 | helix-turn-helix domain-containing protein | - |
| R6Y98_RS12525 (R6Y98_12525) | - | 2440398..2440664 (+) | 267 | WP_000522028.1 | helix-turn-helix domain-containing protein | - |
| R6Y98_RS12530 (R6Y98_12530) | - | 2440664..2440828 (+) | 165 | WP_000390285.1 | hypothetical protein | - |
| R6Y98_RS12535 (R6Y98_12535) | - | 2440886..2441941 (+) | 1056 | WP_139020006.1 | DnaD domain-containing protein | - |
| R6Y98_RS12540 (R6Y98_12540) | abrB | 2441945..2442223 (+) | 279 | WP_318588524.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| R6Y98_RS12545 (R6Y98_12545) | - | 2442216..2442575 (+) | 360 | WP_001125962.1 | hypothetical protein | - |
| R6Y98_RS12550 (R6Y98_12550) | - | 2442594..2442761 (+) | 168 | WP_000717825.1 | DUF3954 domain-containing protein | - |
| R6Y98_RS12555 (R6Y98_12555) | - | 2442787..2443038 (+) | 252 | WP_042991632.1 | hypothetical protein | - |
| R6Y98_RS12560 (R6Y98_12560) | - | 2443058..2443540 (+) | 483 | WP_318588525.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| R6Y98_RS12565 (R6Y98_12565) | - | 2443686..2444474 (-) | 789 | WP_078386100.1 | sulfotransferase family 2 domain-containing protein | - |
| R6Y98_RS12570 (R6Y98_12570) | - | 2445346..2445486 (-) | 141 | WP_318588526.1 | hypothetical protein | - |
| R6Y98_RS12575 (R6Y98_12575) | - | 2445852..2446139 (-) | 288 | WP_044585247.1 | DUF4183 domain-containing protein | - |
| R6Y98_RS12580 (R6Y98_12580) | - | 2447016..2447585 (-) | 570 | WP_046392731.1 | cupin domain-containing protein | - |
| R6Y98_RS12585 (R6Y98_12585) | - | 2448210..2448494 (-) | 285 | WP_001123250.1 | DUF4183 domain-containing protein | - |
| R6Y98_RS12590 (R6Y98_12590) | - | 2448690..2448812 (+) | 123 | WP_098976266.1 | DUF3983 domain-containing protein | - |
| R6Y98_RS12595 (R6Y98_12595) | - | 2448833..2449021 (+) | 189 | WP_001013579.1 | hypothetical protein | - |
| R6Y98_RS12600 (R6Y98_12600) | - | 2449120..2449290 (+) | 171 | WP_318588527.1 | hypothetical protein | - |
| R6Y98_RS12605 (R6Y98_12605) | - | 2449318..2449800 (+) | 483 | WP_000166181.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| R6Y98_RS12610 (R6Y98_12610) | - | 2449800..2450342 (+) | 543 | WP_318588528.1 | site-specific integrase | - |
| R6Y98_RS12615 (R6Y98_12615) | - | 2450541..2451392 (+) | 852 | WP_318588529.1 | leucine-rich repeat domain-containing protein | - |
| R6Y98_RS12620 (R6Y98_12620) | - | 2451853..2452500 (+) | 648 | WP_000504995.1 | hypothetical protein | - |
| R6Y98_RS12625 (R6Y98_12625) | - | 2452876..2453058 (+) | 183 | WP_000443959.1 | hypothetical protein | - |
| R6Y98_RS12630 (R6Y98_12630) | - | 2453090..2453329 (+) | 240 | WP_000002732.1 | hypothetical protein | - |
| R6Y98_RS12635 (R6Y98_12635) | - | 2453346..2453561 (+) | 216 | WP_000773608.1 | hypothetical protein | - |
| R6Y98_RS12640 (R6Y98_12640) | - | 2453697..2453951 (+) | 255 | WP_000378700.1 | hypothetical protein | - |
| R6Y98_RS12645 (R6Y98_12645) | - | 2453944..2454282 (+) | 339 | WP_000333446.1 | hypothetical protein | - |
| R6Y98_RS12650 (R6Y98_12650) | - | 2454287..2454517 (+) | 231 | WP_000964491.1 | hypothetical protein | - |
| R6Y98_RS12655 (R6Y98_12655) | - | 2454510..2454845 (+) | 336 | WP_001008153.1 | HNH endonuclease | - |
| R6Y98_RS12660 (R6Y98_12660) | - | 2454969..2455280 (+) | 312 | WP_069355644.1 | P27 family phage terminase small subunit | - |
| R6Y98_RS12665 (R6Y98_12665) | - | 2455277..2456944 (+) | 1668 | WP_318588530.1 | terminase large subunit domain-containing protein | - |
| R6Y98_RS12670 (R6Y98_12670) | - | 2456953..2458116 (+) | 1164 | WP_318588531.1 | phage portal protein | - |
| R6Y98_RS12675 (R6Y98_12675) | - | 2458100..2458882 (+) | 783 | WP_318588532.1 | head maturation protease, ClpP-related | - |
| R6Y98_RS12680 (R6Y98_12680) | - | 2458886..2460040 (+) | 1155 | WP_097914669.1 | phage major capsid protein | - |
| R6Y98_RS12685 (R6Y98_12685) | - | 2460046..2460339 (+) | 294 | WP_029442425.1 | hypothetical protein | - |
| R6Y98_RS12690 (R6Y98_12690) | - | 2460341..2460694 (+) | 354 | WP_242259621.1 | phage head closure protein | - |
| R6Y98_RS12695 (R6Y98_12695) | - | 2460696..2461040 (+) | 345 | WP_029442427.1 | HK97 gp10 family phage protein | - |
| R6Y98_RS12700 (R6Y98_12700) | - | 2461037..2461366 (+) | 330 | WP_071730276.1 | hypothetical protein | - |
| R6Y98_RS12705 (R6Y98_12705) | - | 2461367..2461963 (+) | 597 | WP_001031291.1 | major tail protein | - |
| R6Y98_RS12710 (R6Y98_12710) | - | 2461968..2462330 (+) | 363 | WP_016124652.1 | hypothetical protein | - |
| R6Y98_RS12715 (R6Y98_12715) | - | 2462561..2464018 (+) | 1458 | Protein_2425 | DUF2207 domain-containing protein | - |
| R6Y98_RS12720 (R6Y98_12720) | - | 2464242..2466395 (+) | 2154 | WP_318588533.1 | phage tail tape measure protein | - |
| R6Y98_RS12725 (R6Y98_12725) | - | 2466437..2467912 (+) | 1476 | WP_318588534.1 | distal tail protein Dit | - |
| R6Y98_RS12730 (R6Y98_12730) | - | 2467909..2472567 (+) | 4659 | WP_318588535.1 | phage tail spike protein | - |
| R6Y98_RS12735 (R6Y98_12735) | - | 2472607..2473005 (+) | 399 | WP_318588536.1 | phage holin family protein | - |
| R6Y98_RS12740 (R6Y98_12740) | - | 2473032..2473967 (+) | 936 | WP_318588537.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10098.69 Da Isoelectric Point: 5.7190
>NTDB_id=900666 R6Y98_RS12540 WP_318588524.1 2441945..2442223(+) (abrB) [Bacillus cereus strain GUCC 3]
MKNTGVARKVDELGRVVIPVELRRTLGIVEGMALDFHIDGENIVLRKHEKSCFVTGEVSETNIELLGGRMFLSKEGASEL
LNFIQKSGLADA
MKNTGVARKVDELGRVVIPVELRRTLGIVEGMALDFHIDGENIVLRKHEKSCFVTGEVSETNIELLGGRMFLSKEGASEL
LNFIQKSGLADA
Nucleotide
Download Length: 279 bp
>NTDB_id=900666 R6Y98_RS12540 WP_318588524.1 2441945..2442223(+) (abrB) [Bacillus cereus strain GUCC 3]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGAATGGCACTAGATTTTCATATCGATGGTGAAAACATTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAAGTGAATTA
CTGAATTTTATTCAGAAGAGTGGGCTGGCAGATGCCTAA
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGAATGGCACTAGATTTTCATATCGATGGTGAAAACATTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAAGTGAATTA
CTGAATTTTATTCAGAAGAGTGGGCTGGCAGATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
58.621 |
94.565 |
0.554 |