Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   R6I10_RS13935 Genome accession   NZ_CP137695
Coordinates   2651985..2652395 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis isolate FELIX_MS382     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2647351..2698841 2651985..2652395 within 0


Gene organization within MGE regions


Location: 2647351..2698841
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6I10_RS13910 (R6I10_13910) yqeF 2647518..2648249 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  R6I10_RS13915 (R6I10_13915) cwlH 2648501..2649253 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  R6I10_RS13920 (R6I10_13920) yqeD 2649440..2650066 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  R6I10_RS13925 (R6I10_13925) gnd 2650085..2650978 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  R6I10_RS13930 (R6I10_13930) yqeB 2651230..2651952 (+) 723 WP_010886572.1 hypothetical protein -
  R6I10_RS13935 (R6I10_13935) nucA/comI 2651985..2652395 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  R6I10_RS13940 (R6I10_13940) - 2652591..2652941 (+) 351 Protein_2699 sigma-70 family RNA polymerase sigma factor -
  R6I10_RS13945 (R6I10_13945) spoIVCA 2652969..2654429 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  R6I10_RS13950 (R6I10_13950) - 2654387..2654565 (-) 179 Protein_2701 hypothetical protein -
  R6I10_RS13955 (R6I10_13955) arsC 2654920..2655339 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  R6I10_RS13960 (R6I10_13960) acr3 2655351..2656391 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  R6I10_RS13965 (R6I10_13965) arsK 2656414..2656854 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  R6I10_RS13970 (R6I10_13970) arsR 2656915..2657232 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  R6I10_RS13975 (R6I10_13975) yqcI 2657604..2658368 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  R6I10_RS13980 (R6I10_13980) rapE 2658811..2659938 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  R6I10_RS13985 (R6I10_13985) phrE 2659928..2660062 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  R6I10_RS13990 (R6I10_13990) - 2660172..2660330 (+) 159 WP_003245945.1 hypothetical protein -
  R6I10_RS13995 (R6I10_13995) yqcG 2660700..2662295 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  R6I10_RS14000 (R6I10_14000) yqcF 2662310..2662888 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  R6I10_RS14005 (R6I10_14005) - 2663006..2663152 (+) 147 WP_009967791.1 hypothetical protein -
  R6I10_RS14010 (R6I10_14010) - 2663149..2663511 (-) 363 WP_003229947.1 hypothetical protein -
  R6I10_RS14015 (R6I10_14015) - 2663527..2664006 (-) 480 WP_004399085.1 hypothetical protein -
  R6I10_RS14020 (R6I10_14020) cwlA 2664171..2664989 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  R6I10_RS14025 (R6I10_14025) skhD 2665034..2665456 (-) 423 WP_003246208.1 holin family protein -
  R6I10_RS14030 (R6I10_14030) xepA 2665501..2666394 (-) 894 WP_003246010.1 phage-like element PBSX protein XepA -
  R6I10_RS14035 (R6I10_14035) yqcE 2666482..2666646 (-) 165 WP_003229944.1 XkdX family protein -
  R6I10_RS14040 (R6I10_14040) yqcD 2666643..2666978 (-) 336 WP_009967793.1 XkdW family protein -
  R6I10_RS14045 (R6I10_14045) yqcC 2666988..2668088 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  R6I10_RS14050 (R6I10_14050) - 2668091..2668363 (-) 273 WP_003229942.1 hypothetical protein -
  R6I10_RS14055 (R6I10_14055) yqcA 2668360..2668938 (-) 579 WP_003229941.1 YmfQ family protein -
  R6I10_RS14060 (R6I10_14060) yqbT 2668922..2669968 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  R6I10_RS14065 (R6I10_14065) yqbS 2669961..2670386 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  R6I10_RS14070 (R6I10_14070) yqbR 2670399..2670662 (-) 264 WP_003229938.1 DUF2577 family protein -
  R6I10_RS14075 (R6I10_14075) yqbQ 2670659..2671639 (-) 981 WP_004398524.1 hypothetical protein -
  R6I10_RS14080 (R6I10_14080) yqbP 2671652..2672311 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  R6I10_RS14085 (R6I10_14085) yqbO 2672304..2677061 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  R6I10_RS14090 (R6I10_14090) - 2677064..2677201 (-) 138 WP_003229934.1 hypothetical protein -
  R6I10_RS14095 (R6I10_14095) - 2677243..2677692 (-) 450 WP_003229933.1 phage tail assembly chaperone -
  R6I10_RS14100 (R6I10_14100) txpA 2677838..2678017 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  R6I10_RS14105 (R6I10_14105) bsrH 2678397..2678486 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  R6I10_RS14110 (R6I10_14110) yqbM 2678740..2679183 (-) 444 WP_003229930.1 phage tail tube protein -
  R6I10_RS14115 (R6I10_14115) yqbK 2679186..2680586 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  R6I10_RS14120 (R6I10_14120) - 2680587..2680778 (-) 192 WP_010886574.1 hypothetical protein -
  R6I10_RS14125 (R6I10_14125) yqbJ 2680775..2681212 (-) 438 WP_003229927.1 DUF6838 family protein -
  R6I10_RS14130 (R6I10_14130) yqbI 2681225..2681728 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  R6I10_RS14135 (R6I10_14135) yqbH 2681725..2682087 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  R6I10_RS14140 (R6I10_14140) gkpG 2682084..2682479 (-) 396 WP_004398566.1 DUF3199 family protein -
  R6I10_RS14145 (R6I10_14145) yqbF 2682483..2682794 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  R6I10_RS14150 (R6I10_14150) skdG 2682805..2683740 (-) 936 WP_003229922.1 phage major capsid protein -
  R6I10_RS14155 (R6I10_14155) yqbD 2683759..2684727 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  R6I10_RS14160 (R6I10_14160) - 2684760..2685413 (-) 654 WP_003229920.1 hypothetical protein -
  R6I10_RS14165 (R6I10_14165) yqbB 2685454..2686371 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  R6I10_RS14170 (R6I10_14170) yqbA 2686368..2687900 (-) 1533 WP_004398894.1 phage portal protein -
  R6I10_RS14175 (R6I10_14175) stmB 2687904..2689199 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  R6I10_RS14180 (R6I10_14180) terS 2689192..2689911 (-) 720 WP_003229916.1 phage terminase small subunit -
  R6I10_RS14185 (R6I10_14185) - 2689979..2690443 (-) 465 WP_004398685.1 hypothetical protein -
  R6I10_RS14190 (R6I10_14190) yqaQ 2690587..2691042 (-) 456 WP_004398775.1 hypothetical protein -
  R6I10_RS14195 (R6I10_14195) - 2691240..2692169 (+) 930 WP_003229913.1 hypothetical protein -
  R6I10_RS14200 (R6I10_14200) yqaO 2692243..2692449 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  R6I10_RS14205 (R6I10_14205) yqaN 2692531..2692959 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  R6I10_RS14210 (R6I10_14210) - 2693055..2693204 (-) 150 WP_003229910.1 hypothetical protein -
  R6I10_RS14215 (R6I10_14215) sknM 2693195..2694136 (-) 942 WP_075058863.1 ATP-binding protein -
  R6I10_RS14220 (R6I10_14220) yqaL 2694018..2694695 (-) 678 WP_010886575.1 DnaD domain-containing protein -
  R6I10_RS14225 (R6I10_14225) recT 2694771..2695625 (-) 855 WP_003229907.1 recombinase RecT -
  R6I10_RS14230 (R6I10_14230) yqaJ 2695628..2696587 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  R6I10_RS14235 (R6I10_14235) yqaI 2696693..2696887 (-) 195 WP_003229905.1 YqaI family protein -
  R6I10_RS14240 (R6I10_14240) - 2696847..2697020 (-) 174 WP_119123069.1 hypothetical protein -
  R6I10_RS14245 (R6I10_14245) sknH 2697017..2697274 (-) 258 WP_003245994.1 YqaH family protein -
  R6I10_RS14250 (R6I10_14250) yqaG 2697271..2697840 (-) 570 WP_004398626.1 helix-turn-helix domain-containing protein -
  R6I10_RS14255 (R6I10_14255) - 2697914..2698054 (-) 141 WP_003229902.1 hypothetical protein -
  R6I10_RS14260 (R6I10_14260) yqaF 2698084..2698314 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  R6I10_RS14265 (R6I10_14265) sknR 2698491..2698841 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=899891 R6I10_RS13935 WP_009967785.1 2651985..2652395(-) (nucA/comI) [Bacillus subtilis isolate FELIX_MS382]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=899891 R6I10_RS13935 WP_009967785.1 2651985..2652395(-) (nucA/comI) [Bacillus subtilis isolate FELIX_MS382]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529