Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   R6I10_RS13345 Genome accession   NZ_CP137695
Coordinates   2552043..2552216 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate FELIX_MS382     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547043..2557216
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6I10_RS13330 (R6I10_13330) gcvT 2547842..2548930 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  R6I10_RS13335 (R6I10_13335) hepAA 2549372..2551045 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  R6I10_RS13340 (R6I10_13340) yqhG 2551066..2551860 (+) 795 WP_003230200.1 YqhG family protein -
  R6I10_RS13345 (R6I10_13345) sinI 2552043..2552216 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  R6I10_RS13350 (R6I10_13350) sinR 2552250..2552585 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  R6I10_RS13355 (R6I10_13355) tasA 2552678..2553463 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  R6I10_RS13360 (R6I10_13360) sipW 2553527..2554099 (-) 573 WP_003246088.1 signal peptidase I SipW -
  R6I10_RS13365 (R6I10_13365) tapA 2554083..2554844 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  R6I10_RS13370 (R6I10_13370) yqzG 2555116..2555442 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  R6I10_RS13375 (R6I10_13375) spoIITA 2555484..2555663 (-) 180 WP_003230176.1 YqzE family protein -
  R6I10_RS13380 (R6I10_13380) comGG 2555734..2556108 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  R6I10_RS13385 (R6I10_13385) comGF 2556109..2556492 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  R6I10_RS13390 (R6I10_13390) comGE 2556518..2556865 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=899878 R6I10_RS13345 WP_003230187.1 2552043..2552216(+) (sinI) [Bacillus subtilis isolate FELIX_MS382]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=899878 R6I10_RS13345 WP_003230187.1 2552043..2552216(+) (sinI) [Bacillus subtilis isolate FELIX_MS382]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1