Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   R6Y88_RS19480 Genome accession   NZ_CP137687
Coordinates   3809838..3810011 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain YT-4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3804838..3815011
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6Y88_RS19435 comGE 3805190..3805537 (+) 348 WP_015384088.1 ComG operon protein 5 Machinery gene
  R6Y88_RS19440 comGF 3805563..3805946 (+) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  R6Y88_RS19445 comGG 3805947..3806321 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  R6Y88_RS19450 spoIITA 3806393..3806572 (+) 180 WP_003230176.1 YqzE family protein -
  R6Y88_RS19455 yqzG 3806614..3806940 (-) 327 WP_015384086.1 YqzG/YhdC family protein -
  R6Y88_RS19460 tapA 3807210..3807971 (+) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  R6Y88_RS19465 sipW 3807955..3808527 (+) 573 WP_080030740.1 signal peptidase I SipW -
  R6Y88_RS19470 tasA 3808591..3809376 (+) 786 WP_003230183.1 biofilm matrix protein TasA -
  R6Y88_RS19475 sinR 3809469..3809804 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  R6Y88_RS19480 sinI 3809838..3810011 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  R6Y88_RS19485 yqhG 3810194..3810988 (-) 795 WP_003230200.1 YqhG family protein -
  R6Y88_RS19490 hepAA 3811009..3812682 (-) 1674 WP_015384082.1 DEAD/DEAH box helicase -
  R6Y88_RS19495 gcvT 3813124..3814212 (+) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=899769 R6Y88_RS19480 WP_003230187.1 3809838..3810011(-) (sinI) [Bacillus subtilis strain YT-4]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=899769 R6Y88_RS19480 WP_003230187.1 3809838..3810011(-) (sinI) [Bacillus subtilis strain YT-4]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1