Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   ABC806_RS08485 Genome accession   NZ_CP155539
Coordinates   1640399..1640548 (-) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   Q9FBH1
Organism   Streptococcus pneumoniae TIGR4     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 1635399..1645548
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABC806_RS08450 (ABC806_08440) trmB 1635642..1636277 (-) 636 WP_001266083.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  ABC806_RS08455 (ABC806_08445) ccrZ 1636274..1637068 (-) 795 WP_000363002.1 cell cycle regulator CcrZ -
  ABC806_RS08460 (ABC806_08450) - 1637229..1637840 (-) 612 WP_000394045.1 type II CAAX endopeptidase family protein -
  ABC806_RS08465 (ABC806_08455) blpZ 1637991..1638224 (-) 234 WP_000276498.1 immunity protein BlpZ -
  ABC806_RS08470 (ABC806_08460) - 1638266..1638955 (-) 690 WP_000760538.1 CPBP family intramembrane glutamic endopeptidase -
  ABC806_RS08475 (ABC806_08465) - 1639007..1639390 (-) 384 WP_000877381.1 hypothetical protein -
  ABC806_RS08480 (ABC806_08470) - 1640176..1640295 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  ABC806_RS08485 (ABC806_08475) cipB 1640399..1640548 (-) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  ABC806_RS08490 (ABC806_08480) blpN 1640792..1640995 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  ABC806_RS08495 (ABC806_08485) blpM 1641011..1641265 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  ABC806_RS08505 (ABC806_08495) - 1642422..1642826 (-) 405 WP_000846943.1 hypothetical protein -
  ABC806_RS08510 (ABC806_08500) - 1642823..1642987 (-) 165 WP_000727118.1 hypothetical protein -
  ABC806_RS08515 (ABC806_08505) - 1643284..1643403 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  ABC806_RS08520 (ABC806_08510) blpU 1643406..1643636 (-) 231 WP_000379967.1 bacteriocin-like peptide BlpU -
  ABC806_RS08525 (ABC806_08515) blpJ 1643705..1643974 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  ABC806_RS08530 (ABC806_08520) blpI 1644441..1644638 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  ABC806_RS08535 (ABC806_08525) comA/nlmT 1644920..1645507 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=897448 ABC806_RS08485 WP_001818346.1 1640399..1640548(-) (cipB) [Streptococcus pneumoniae TIGR4]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=897448 ABC806_RS08485 WP_001818346.1 1640399..1640548(-) (cipB) [Streptococcus pneumoniae TIGR4]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9FBH1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51