Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   ABC799_RS08435 Genome accession   NZ_CP155534
Coordinates   1620999..1621148 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain DCC1476     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 1615999..1626148
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABC799_RS08405 (ABC799_08405) - 1616122..1616733 (-) 612 WP_000638370.1 type II CAAX endopeptidase family protein -
  ABC799_RS08410 (ABC799_08410) - 1616915..1618261 (-) 1347 WP_025168898.1 IS1380-like element ISSpn5 family transposase -
  ABC799_RS08415 (ABC799_08415) blpZ 1618592..1618825 (-) 234 WP_000276498.1 immunity protein BlpZ -
  ABC799_RS08420 (ABC799_08420) - 1618867..1619556 (-) 690 WP_000760521.1 CPBP family intramembrane glutamic endopeptidase -
  ABC799_RS08425 (ABC799_08425) - 1619571..1619990 (-) 420 WP_000877385.1 hypothetical protein -
  ABC799_RS08430 (ABC799_08430) - 1620776..1620895 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  ABC799_RS08435 (ABC799_08435) cipB 1620999..1621148 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  ABC799_RS08440 (ABC799_08440) blpN 1621392..1621595 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  ABC799_RS08445 (ABC799_08445) blpM 1621611..1621865 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  ABC799_RS08450 (ABC799_08450) - 1622015..1622819 (-) 805 Protein_1623 IS5 family transposase -
  ABC799_RS08455 (ABC799_08455) - 1623017..1623421 (-) 405 WP_000846944.1 hypothetical protein -
  ABC799_RS08460 (ABC799_08460) - 1623418..1623582 (-) 165 WP_000727118.1 hypothetical protein -
  ABC799_RS08465 (ABC799_08465) - 1623879..1623998 (-) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  ABC799_RS08470 (ABC799_08470) blpU 1624001..1624231 (-) 231 WP_000379964.1 bacteriocin-like peptide BlpU -
  ABC799_RS08475 (ABC799_08475) blpJ 1624300..1624569 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  ABC799_RS08480 (ABC799_08480) blpI 1625036..1625233 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  ABC799_RS08485 (ABC799_08485) comA/nlmT 1625515..1626102 (+) 588 WP_001810228.1 cysteine peptidase family C39 domain-containing protein Regulator

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=896971 ABC799_RS08435 WP_001809846.1 1620999..1621148(-) (cipB) [Streptococcus pneumoniae strain DCC1476]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=896971 ABC799_RS08435 WP_001809846.1 1620999..1621148(-) (cipB) [Streptococcus pneumoniae strain DCC1476]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531