Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4707_RS08435 Genome accession   NZ_CP137113
Coordinates   1595501..1595650 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain ZGX     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1590501..1600650
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4707_RS08410 blpC 1590765..1590920 (-) 156 WP_000358812.1 quorum-sensing system pheromone BlpC -
  R4707_RS08415 - 1590977..1592338 (-) 1362 WP_001069064.1 bacteriocin secretion accessory protein -
  R4707_RS08420 comA/nlmT 1592349..1594502 (-) 2154 WP_000205159.1 peptide cleavage/export ABC transporter BlpA Regulator
  R4707_RS08425 blpM 1594784..1595038 (+) 255 WP_001093255.1 two-peptide bacteriocin subunit BlpM -
  R4707_RS08430 blpN 1595054..1595257 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  R4707_RS08435 cipB 1595501..1595650 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  R4707_RS08440 - 1595754..1595873 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R4707_RS08445 - 1596341..1596712 (+) 372 WP_001810529.1 hypothetical protein -
  R4707_RS08450 - 1597065..1597258 (+) 194 Protein_1619 hypothetical protein -
  R4707_RS08455 - 1597341..1597724 (+) 384 WP_180377195.1 immunity protein -
  R4707_RS08460 - 1597776..1598465 (+) 690 WP_000760515.1 CPBP family intramembrane glutamic endopeptidase -
  R4707_RS08465 blpZ 1598507..1598740 (+) 234 WP_000276498.1 immunity protein BlpZ -
  R4707_RS08470 - 1598891..1599502 (+) 612 WP_000394030.1 CPBP family intramembrane glutamic endopeptidase -
  R4707_RS08475 ccrZ 1599664..1600458 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=896134 R4707_RS08435 WP_001809846.1 1595501..1595650(+) (cipB) [Streptococcus pneumoniae strain ZGX]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=896134 R4707_RS08435 WP_001809846.1 1595501..1595650(+) (cipB) [Streptococcus pneumoniae strain ZGX]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531